KEGG   Plasmodium falciparum 3D7: MAL7P1.113Help
Entry
MAL7P1.113        CDS       T00095                                 

Definition
DEAD box helicase, putative
Orthology
K14806  
ATP-dependent RNA helicase DDX31/DBP7 [EC:3.6.4.13]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     MAL7P1.113
Protein phosphatases and associated proteins [BR:pfa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MAL7P1.113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
7:977661..980360
Genome map
AA seq 899 aa AA seqDB search
MNKHDQKKKRNKQHTDNVMGKKSKGFIKNKKNIGESGNEKKRNNNFNNIWKKKKRSGNSE
KDQVDILGLLKGDSENMNDDDDNNMNDDYNNNNIKGDYNNNNIKDDDVDDDDYDDDDDDN
FDENKNCNDNCSSKHKRNVPSKKEHDILELNNINFNETRKKMINYKNIFDGKFCDLKYIL
SESLINTLEKNEFIKMTSIQKMSIPLFFKPNDIFLKSMTGSGKTLCYAIPSIEKILNMKE
KVKITRDMGIFVLVLSPTRELAIQINNLFCILTKPYPYIVASCITGGEKKKSEKNRLKKG
ISILTCTPGRLLDHLENTKSLKLTFLKMVILDEADKIIYLGTQDKIKLIYDMIRKIKQEE
FSKVHKKKKKEENEVLDHINDTNMSDMNNISNDHSNDYEQFILDKFQMIFISATLNHAMK
TLANYCLTNNTMWIEKEKKNGINGGNKNDETKQKSNDMISCMNRENSPLNIHNNDDNDDN
DDNDENNGDNNNNNDDNNNNNDDNNNKNNDDDNNNTYELPEQLKQYCILIDMKQKFICLI
YMLLDCIEKKKKPVVFLSNHHSVEYLQILLKNIYWPTDVNKKNIEVNKKLNEKITPVLER
EDEKLLRKHLEQNILNNNYYNNNYNVGNISYKNINLEEIQNEDELNDEPGNLYNINADKH
KRIYLFNNVNIYILHGNLSKEDRLGNFMDFSKTNNSILLCTDIISRGIHFDSLSVVIQYD
PPQILEEYIHKVGRTARLNKQGSAYLFLLKSQKQFLNILKNKNIQLKIILGNTIINHFKK
FCIPNFLKSVGKDILNFLHNHMQTIVKSNNTLMEKGTSAFLCTITSFYSTSKNLRSIFNA
KDIHLGHLAYTFLLEKTPKQISKYKKEQNYINIKKQTVLSKKEKRLLKSKQFQKKQKRK
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcatgatcaaaaaaagaaaagaaacaaacaacatactgacaatgtgatgggt
aaaaaatccaagggatttattaaaaacaagaaaaatatcggagaatcaggaaacgaaaaa
aaaagaaataataactttaataatatttggaagaagaaaaagagaagtggaaattcggaa
aaagatcaagttgacatactaggattattaaaaggtgatagtgaaaatatgaatgatgat
gatgataataatatgaacgatgattataataataataatattaaaggtgattataataat
aataatattaaagatgatgatgttgatgatgatgattatgatgatgatgatgatgacaat
tttgatgagaacaaaaattgtaatgataattgttcttctaagcataaaagaaatgtacca
tcaaaaaaagaacatgacattttagaattaaataatataaattttaatgagacaagaaaa
aaaatgataaattataaaaatatttttgatgggaaattttgtgatttaaaatatattttg
agtgaaagtttaataaatacattagaaaaaaatgaatttataaaaatgacaagtatacaa
aaaatgagtattcctttattttttaaaccgaatgatatttttttaaaatcgatgacaggt
tctggtaagaccttatgttatgctataccatcaatagaaaagatattaaatatgaaagaa
aaagtaaaaattacaagagatatgggtatcttcgttttggttttatcacctacaagagaa
ttagctatacaaataaataatttattttgtattttaacgaaaccatatccatatatagta
gcatcttgtataacagggggggaaaaaaagaagtctgaaaaaaatcgattgaaaaaaggt
atatctatattgacatgtacacctgggagattattggatcatttggaaaatacaaaatcg
ttaaaacttacatttttaaaaatggtaatattagatgaagccgataaaataatatatttg
gggacacaagacaaaataaaacttatatatgacatgataagaaaaattaagcaagaggag
ttttcgaaagttcacaaaaaaaagaaaaaagaagaaaatgaagttcttgatcacataaat
gatacaaatatgagtgatatgaataatattagtaatgatcactcaaacgattatgaacaa
tttattttagataaattccaaatgatctttatctcggcaactctaaatcatgctatgaaa
acattagctaattattgtctaactaataatactatgtggatagaaaaagaaaagaaaaat
ggcattaatggaggaaataaaaatgatgaaacgaaacaaaaatcgaatgatatgatctca
tgtatgaatcgagagaactcccccctcaatatccataataatgatgataatgatgataat
gatgataatgatgaaaataatggtgataataataataacaatgatgataataataataac
aatgatgataataataataaaaataatgatgatgataataataacacatatgaacttccc
gaacaactaaagcaatactgtatacttatagatatgaaacaaaaatttatatgtttaata
tacatgttattagattgtatagaaaagaaaaagaagccagtggtgtttttatcaaatcat
catagtgttgaatatttacaaatattattaaaaaatatttattggccaacagatgtaaat
aaaaaaaatatcgaagtaaataaaaaattaaatgaaaagataactcctgtattagaaaga
gaagatgagaaattattaagaaaacatttagaacaaaatatattaaataataattattat
aataataattataatgttggaaatatttcttacaaaaatataaatttagaagaaatacaa
aatgaagatgaactaaatgatgaaccagggaatttatataatatcaatgctgataaacat
aaaagaatttatttatttaacaatgtaaatatatatatattacatggaaatctatctaaa
gaagatcgtttaggaaattttatggacttttcaaaaaccaataattctattttattatgt
acagatattatatccagaggtattcattttgattccttaagtgtagttatacaatatgat
ccaccacaaatcttagaagaatatatacataaagttggaagaacagctagattaaataaa
caaggttcagcttatttattcctactaaagtcacaaaaacagtttttaaatatattaaaa
aataaaaatatacaattaaaaattatcttaggaaatacaataattaaccatttcaaaaaa
ttttgtattcccaattttctaaaatcggtaggaaaagatattttaaactttctacacaat
catatgcaaacaatagttaaatcaaataatactcttatggaaaaaggaactagcgcattc
ttatgtactattacttctttttattcaaccagcaaaaatctaagatctatttttaatgca
aaagatatacacctaggtcatttggcctacacatttctgttagaaaaaacgccaaagcaa
atttcaaaatataaaaaagaacaaaattatattaacattaaaaaacagactgttcttagt
aagaaggaaaagagattgttaaagtctaagcaattccagaaaaagcaaaagaggaaataa

DBGET integrated database retrieval system