KEGG   Plasmodium falciparum 3D7: MAL8P1.1Help
Entry
MAL8P1.1          CDS       T00095                                 

Gene name
3D7Surf8.1
Definition
(RefSeq) surface-associated interspersed gene 8.1, (SURFIN8.1)
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1326215..1327079,1327247..1327473,1327585..1332258)
Genome map
AA seq 1921 aa AA seqDB search
MAIISSIPNYRKGLNPSLYNLRFSLFRDRVNAYTISKIKKLKKSRNYKRLCRYLNYKLDD
IKDVFMLNNVLGIPRTARMGLWENVMENKLKDIIEENSDNKCRRIYPYFQRIQRRRRKAL
ENFCEDKEKKQEELKNVKFDMKKCLEFNEWVKESENKIFKLFKNNITERDKRKKAYIISD
KCKLGNLNTLFGQMDCSDKIDRHFPYIFLEGNPVYPSEKDDDKNIKDPEEGKDEEEEEED
GEVTINIRSNGEKGFRFVNNTLVLEGIEGSGFDLDFETYDISPHSLNSGEIANLFEFNNE
SHLEHMNIESNRSPNMVDIDFSDVPLTAAHMTSSITAKNISSYLYVPLGVLFIIISFIWF
FLNRTKHLNMLIKEKEKVKTENIVPSEAYVKLDDLEVMSEEIKEKQKEKLKKKIHAQKKL
EIIEDPYKIKLLERKKWLWKTIIEIHMLILEEQRKAEWEFNKGDFLNICIDEFSNQEKKP
DTNIITSDLPFDEPEVIETIRMMNKQSDIWYRWVERHAHMLEKWKEEEWFLRLKESWKDE
EEEYMKRAYKELLISLRGDKYHMSQRQKIIWRKWIAKHPYRIREFVIDKWFNQLFEELEK
EGIISDEAIRNFLSQYEEAYDEEKIQEFIKYKKKVLVVILWIKIYMSMLEEYVKEEDIES
EKLFIDTSLEELKKKKEIEEEVLEDLKKDIYESDEMKEIEKYKGEDWFKQMQQDWIRRDY
KFVSSYNLESDDEEQFHEFVKKPTVEIQKDLLKEQWKNIELKWIEEDNYDEYVLEDELLK
ETKYIKPKDKMKHRIIKEDNIYGEQLKVFDEIEKRSIYLSSKRVLKWKTIIEIHLEVLHD
CKKEEWDKNKRDFLNICIEELVKGQNEDKKNKENYNYITNESDNYDIVEYTKSFCNTWKD
RHNYMLEKWNKENWFVQLKNDWVEEQNEYMRKTYKELLISLKGDKYNMSQRQKIIWRKWI
AKHPYKINEEIINIWLNRLSDERDKNGIISDEAIKKFLSLEKDISDKDFLKYRRKKLEVI
LWVKIYMSVLEEEKNEELEKSKESFLNTCIDELKKEEYSEENERMITIVDEMKKGFRICD
KVEDYKKKKWKNEEWYKDLKKEWIKEEDKYIDSIYLMKKDEIYEDDLLNKSIVELEKSVS
LKHWKDMYIKWIDEDNERDWLRIAIDKKNLKTDEINEDINRMIELNMLEDYSNDLYDKKK
IKWKTIIEIHMEVLNDCKNDEWEMNKGDFLDICLEEFGTMENKEYSHIINNMLMVGELEY
KHLNMDVIERQNDLWNKWIEGHRYMLEKWKKEKWFIVLKENWKNEEHKYMRKAYLELLMS
LREDVKNPLLQRQKIIWRKWIAKNLYHIESNVIKKWFDTLLEEIERKGVIELDGCINLIE
MEENEEYLEYLKEYRKKKLICIIWIKIYMMIIEEHKKEEYLECKEIFLDTCVDELREQEI
LEGNELYMDDMKTSILLNDQKEEIEKLKMKKWYKDLKKEWIIEENRYFRSIINEEDDEEY
KNMISKPLRDVEKKISKKHWEDIQLKWIDEDNERDWLKIARNENEEIKYLYINENVSKKK
KKVPFYIDDYRKKGRSNKNKIYRRKREKCNVKLNENNTMNKEMENWENRMEFLKICVDLL
KKRTFYYINIWEKNKAFYDETNEIMKQLEEKIFERQKILWYNKEDMNKMSSKKWGNEEWF
IILKNDWNEEKTCYLNGIQYEYNINNLIEEEKKYLYLKKEKIIWKEWLLKNFKNIEECDN
EDWFNNLMETYKIDEICTINMNGEIHSLGLENTLKRNFLKNIIWIDIFMGVLNACEEEEE
LEEHKHKNMLESKVEDNDKLFYEKNEDYINKNEMENYINDIQENEGNQMDIPDWFDAYQS
DEMSGKQKSIQKDEQWFIKELEEGGIKSDVLQENYTIYNNKLIEQKMNILRESYIRNQND
T
NT seq 5766 nt NT seq  +upstreamnt  +downstreamnt
atggctataattagttcaatacccaattataggaagggactaaacccttctttatataat
ctacgtttttctttattcagagacagagtgaatgcttacactatttctaaaattaaaaaa
ttaaaaaaatctagaaattacaaaagattatgtagatatttaaattataagttagatgat
ataaaggacgtttttatgttaaataatgtattaggtattccaagaacagctcgaatgggt
ttatgggaaaacgttatggaaaataaattaaaagatattatagaagaaaattctgataat
aaatgtagaagaatttatccttattttcaaaggatacaaaggagaaggaggaaggctcta
gagaatttttgtgaggataaggaaaaaaaacaagaagaattaaaaaatgttaaatttgat
atgaaaaaatgcttagaatttaatgaatgggtaaaagaaagtgagaataaaatttttaaa
ttatttaaaaataatataactgaaagggataaacgcaaaaaagcttatattatatctgat
aaatgtaagttgggcaatctaaatacattatttggacaaatggactgttccgataagatt
gatagacattttccttatattttccttgaaggaaatcctgtatatccatctgaaaaggat
gatgataaaaatataaaggatccagaagaaggaaaagatgaggaagaggaagaagaggat
ggagaggttactattaatatccgtagtaatggtgaaaaaggatttcgttttgtcaataat
acacttgttctagaaggaatagaaggttcaggatttgatttggattttgaaacttatgat
atttctcctcattctttaaattctggcgaaatagctaatttattcgaatttaacaatgaa
tcacatcttgaacatatgaatatcgagtcaaacagaagtccgaatatggtagatattgat
ttttctgatgttcctcttactgctgcgcatatgacctcctcgataactgctaaaaatatt
tcatcttacctatatgttcctctaggtgtattattcattattatttcctttatatggttt
ttcctaaatagaacgaaacatttgaatatgttgataaaggaaaaagaaaaagtaaaaaca
gaaaatattgttccttcggaagcatatgtaaaattagacgacttggaagtgatgagtgag
gaaattaaagaaaagcaaaaggaaaaattaaaaaaaaaaatacacgctcaaaaaaaactt
gaaattatagaggacccttataaaattaaattgttagaaagaaagaaatggttatggaaa
actattatagaaatacatatgttaattttggaagaacaaagaaaagcagaatgggaattt
aataaaggagattttttaaatatatgtattgatgaattttcaaatcaggaaaaaaaacca
gatacaaatataataacaagtgatttgccatttgatgaaccagaagttatagaaactata
cgtatgatgaataagcaaagcgatatatggtatagatgggttgaacgacatgcacatatg
ttagaaaaatggaaagaagaagaatggtttttaagattaaaagagagctggaaagatgaa
gaagaagaatatatgaaaagagcttataaagaattattaattagtttaagaggtgataaa
tatcatatgtctcaaaggcaaaaaattatttggagaaaatggattgcaaaacatccatat
agaatcagagaatttgttatagataaatggtttaatcaattatttgaagaactagaaaag
gaaggaatcatatctgatgaggccataagaaattttttatctcaatatgaagaagcatat
gatgaagaaaaaatccaagaatttataaaatataaaaagaaagtgttggtggttatatta
tggataaaaatatatatgtcaatgttggaggaatatgtaaaggaagaagatatagaaagt
gaaaagttatttattgatacatctttggaagaattaaaaaagaaaaaagaaatagaagaa
gaagtgttagaagatttgaaaaaagatatatatgaaagcgatgaaatgaaagaaattgaa
aagtataaaggagaagattggtttaagcaaatgcagcaagattggattaggagagattat
aaatttgtttcgtcatataatttagaaagtgacgatgaagaacagtttcatgaatttgtt
aaaaaaccaacagtggaaatacagaaagatttattaaaagaacaatggaaaaatatagaa
ttgaaatggattgaggaagataattatgatgaatatgtgttagaagatgaattgttaaaa
gaaacgaaatatataaagcctaaagataaaatgaaacatagaataattaaagaggataat
atttatggtgaacaattaaaagtgtttgatgaaatagaaaaaaggagcatttatttgtcg
agtaaaagggtattgaaatggaaaaccatcattgaaatacatttggaggtattacatgat
tgtaaaaaggaagagtgggataaaaataaaagggactttttaaatatatgtatagaagaa
ttggtaaagggacaaaatgaagataaaaaaaataaggaaaattataattatataacaaat
gaaagtgataattacgatatagtggaatataccaaatcattttgtaatacgtggaaagat
agacacaattatatgttagaaaaatggaataaagaaaattggtttgttcaattgaaaaat
gattgggtggaggaacaaaatgaatacatgagaaagacatacaaagaattattaattagt
cttaagggtgacaaatataatatgtcgcagagacaaaaaataatttggaggaaatggatt
gcaaaacatccttacaaaataaatgaagaaattataaatatatggttaaatcggttatcg
gatgagagagataaaaatggtattattagtgacgaagctataaaaaagtttttatcttta
gaaaaagatatatcggataaggatttccttaaatataggaggaaaaaattagaagtaatt
ttatgggtaaaaatatatatgtctgttttggaagaggagaaaaatgaagaattagaaaaa
agtaaggagtcctttttaaatacatgcatagatgagttaaaaaaggaagaatattctgaa
gaaaatgaaagaatgataacaatagttgatgaaatgaaaaagggatttcgtatatgtgat
aaggtagaagattacaaaaaaaaaaaatggaaaaatgaagaatggtataaggacttaaag
aaagaatggataaaagaagaagataaatatatagattctatttatttaatgaaaaaggat
gaaatatatgaagatgatttgttgaataaatccattgtggaattagaaaaaagtgtatca
ttaaaacattggaaagatatgtatataaaatggattgatgaagataacgagagagattgg
ttacgtattgcaatagataaaaaaaatttaaaaacagacgaaataaatgaagatataaat
agaatgatagaattaaatatgttggaagattattcaaatgatttgtatgataaaaaaaaa
ataaaatggaaaactatcatcgaaatacatatggaagttttgaatgactgcaaaaatgat
gaatgggaaatgaataaaggagactttttagatatatgcttagaagaatttggaactatg
gaaaacaaggaatattcccatattataaataacatgttgatggtaggagaactagaatat
aaacatttgaatatggatgtaatagaaagacaaaacgatttgtggaacaaatggatagaa
ggacacagatatatgttagaaaaatggaaaaaagaaaaatggtttattgtattgaaagag
aattggaaaaatgaagagcataaatatatgagaaaggcttatttagaattgttgatgagt
ttaagagaggatgttaaaaatccgctgttacaaaggcaaaaaattatatggagaaaatgg
attgcaaaaaatttatatcatatagaatcaaatgttataaaaaaatggtttgatacatta
ttagaagaaattgaaagaaaaggagttattgaattagatggatgtataaatttaatagag
atggaagaaaatgaagaatatttggaatatttaaaagaatatagaaagaaaaaattaata
tgtatcatatggataaaaatatatatgatgataattgaggaacacaaaaaggaggaatat
ttggaatgtaaggaaatatttttggatacttgtgtggatgagttgagagagcaagaaatt
ttggagggtaacgaattatatatggatgatatgaaaacaagtatcctattaaatgatcaa
aaagaagaaatagaaaaattaaaaatgaaaaaatggtataaagatttgaagaaagaatgg
ataattgaagaaaatagatatttcagatcaataataaatgaagaagatgatgaagaatat
aaaaatatgataagcaagccattaagagatgttgagaaaaaaatatcaaaaaagcattgg
gaagatattcaattaaaatggatagatgaagataatgaaagggattggttaaaaattgca
aggaatgaaaatgaagagattaaatatttatatataaatgaaaatgttagcaaaaaaaaa
aaaaaagtacctttttatatagatgattaccgaaaaaaaggaagatcaaataaaaataaa
atatatagaagaaaaagggaaaaatgtaatgtaaaattaaacgaaaataatactatgaat
aaggaaatggaaaattgggaaaacagaatggaatttttaaaaatttgtgttgatttgtta
aaaaaaagaactttttattatataaatatatgggagaaaaataaagcattttatgatgaa
acaaatgagataatgaaacaattggaagaaaaaatatttgaaaggcagaaaatattatgg
tacaataaagaagatatgaataaaatgtcaagcaaaaaatggggaaatgaagaatggttt
attattttgaaaaatgattggaatgaagaaaaaacgtgttatctgaatggaatacaatac
gaatataatattaataatttaatagaagaagaaaaaaaatatttgtacttgaagaaagaa
aagataatatggaaagaatggttattaaaaaattttaaaaatattgaagaatgtgataat
gaagattggtttaataatttaatggaaacatataaaatagatgaaatatgtacaattaat
atgaatggagagatacatagtcttgggttggagaatactctaaagagaaattttttaaaa
aatataatatggattgatatatttatgggagttttaaatgcatgtgaagaagaagaagaa
ttggaagaacacaaacataagaatatgttagagtcaaaagtcgaagataatgataaatta
ttttatgaaaaaaatgaagattatattaataaaaacgaaatggaaaattatataaatgat
atacaagaaaatgaaggaaatcaaatggatattccagattggtttgatgcatatcaatct
gatgaaatgagtggaaaacagaaaagtatccaaaaagatgaacaatggttcattaaagaa
ttagaagaggggggtataaaaagtgatgttttacaagaaaattatacgatatataataac
aaattgatagagcaaaaaatgaatatacttcgagaaagttatattagaaatcaaaatgat
acataa

DBGET integrated database retrieval system