KEGG   Plasmodium falciparum 3D7: MAL8P1.10Help
Entry
MAL8P1.10         CDS       T00095                                 

Definition
(RefSeq) conserved protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1253421..1253576,1253730..1253831,1253935..1254027,1254124..1254214,1254390..1254460,1254601..1254696,1254826..1254867)
Genome map
AA seq 216 aa AA seqDB search
MPQWGAGNTRAIEARMRKKLDKDKKQKELEEKKLEEYWRDDDKKVQAKIQRKMEAENKRQ
QKLDRKKELKALYGEEEKSIKSNKESKSTNKKVTQSEILQKLIEEKKKQLQEEKKKKENL
NVHEMELEDNINHIHRNEQNNYDEYIYATGIDNVISALENVSFEKTKSVKAAYKKYEEEN
LPIVKEEHKGLKLSQYKQMLWKQFKKSAENPMNQKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaatggggtgcaggtaatacgagagctatagaagctcgtatgaggaaaaaatta
gataaagacaagaagcaaaaagaattagaggaaaaaaaattagaagaatactggagagat
gatgataaaaaagttcaagcaaaaatacaaagaaagatggaggctgaaaataagaggcaa
caaaaattggataggaagaaagaattaaaggctttatatggagaagaagaaaaatccata
aaatcaaataaagagagtaaatctacaaataagaaggtcacgcaatctgaaattcttcaa
aaattaattgaagagaaaaagaagcaacttcaagaagaaaaaaagaaaaaggaaaattta
aatgtacatgaaatggaattagaagataatataaatcacatacacagaaatgaacaaaat
aattacgacgaatatatatatgctaccggaattgataatgtcatatctgctttagaaaat
gtgtccttcgaaaaaactaaaagcgtcaaagctgcctataaaaaatatgaagaagaaaat
ttacccattgttaaagaagaacataagggcttgaaattatctcagtataaacaaatgtta
tggaagcagtttaaaaaatcagctgaaaaccctatgaatcaaaaggaataa

DBGET integrated database retrieval system