KEGG   Plasmodium falciparum 3D7: MAL8P1.14Help
Entry
MAL8P1.14         CDS       T00095                                 

Definition
(RefSeq) mitochondrial inner membrane translocase, putative
  KO
K03217  
YidC/Oxa1 family membrane protein insertase
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Protein export
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MAL8P1.14
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    MAL8P1.14
Secretion system [BR:pfa02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   MAL8P1.14
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1225166..1226935)
Genome map
AA seq 589 aa AA seqDB search
MFQQNNSLKCNFNIIFHHISFRTNKGEWTKGLSTNPNKINQIENNKSNINNTYYHIYQYD
KSILVNKFIQMYIKMGYIKNKKNKISIKQNNNIYNKHNINNIYNKHNINNIYNIYNIYYN
TFICSTNNVRNKQSFCNNNVHDKFGGLALFSRFFFTMPINNINNYFNKQHNDKNINDKFD
TSHCEEDPDKGVSKNIDHLKREDEHGKALTNKEMNNNNNNNNNNDDNIYNDDNVYNDDNN
YNDGNIYNNNNDYAYNNKSNEGSTYPLNEEETNVNLTEDIYPYTDFIIEKCKLNIKSDVD
IYENTWYVKLIYDLLNSTKLFFDCTWMSSIIMTTLFMRIIILPLTISSERDRRKQKILSP
LLKELTKKLKDNAQDGNIKKAVEFKKKILNIRNTHGISLIPKSIILMAFFQTPLFFIFYF
SMKRIASYPDIFKDFTFESPLWLDSLSLPDPYYILPILSSLLLLSNNELTLLIDKKINEN
NKQSNLNNQEETEFQKNMKKITKLAMRLFYLSSVLFFKSMPSGLFIYFITNTFFQLFITQ
ICKIKIIENFLDLPPLHSKGFITSTNTSQQQTTSQKKIIHMNDLIKRKK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaacaaaataattccctcaaatgtaattttaatataatttttcatcatatttct
ttcagaacaaataaaggagaatggacaaaggggttgagtaccaacccaaataaaataaat
caaatagaaaataacaaaagtaatataaataatacatattatcatatatatcaatatgac
aaaagtatacttgttaataaattcatacaaatgtatataaaaatggggtacataaagaat
aagaaaaataaaataagtataaaacaaaacaataatatatataacaaacataacataaat
aatatatataacaaacataacataaataatatatataatatatataatatatattataat
acatttatatgtagtacaaataatgtaagaaataaacaatcattttgtaataataatgta
catgataaatttggtgggcttgctctattctcgagattttttttcactatgcccataaac
aatataaataattattttaacaaacaacataatgataaaaacataaatgacaagtttgat
acttcccactgtgaggaagatcctgataagggggtatctaagaacattgatcatctcaaa
agagaagatgaacatgggaaagccttaaccaataaggaaatgaataataataataataat
aataataataatgatgataatatttataatgatgataatgtttataatgatgataataat
tataatgatggtaatatttataataataataatgattatgcttataataacaagagtaat
gaaggaagcacataccctttaaatgaagaagaaactaacgtaaatctaacagaagatata
tatccatatacagatttcattattgaaaaatgtaaacttaatataaaaagtgatgtagat
atatatgaaaacacttggtatgtgaaattaatatatgatttattaaattccacaaaatta
ttttttgattgtacatggatgagttcaattataatgacaacattatttatgagaatcata
attttgcctttaaccatatcttcagaaagagatagaaggaaacaaaaaatattaagtcct
ttattaaaagaattaacaaagaaattaaaagataatgcacaagatggaaatattaaaaaa
gctgtagaatttaaaaaaaaaattttaaatataagaaatacacatggtatatcattaata
ccgaaatctattattttaatggctttctttcaaacacctttattttttatattctatttt
tctatgaaaagaatagcatcttatcctgatatttttaaagactttacttttgaatcccca
ttgtggttagatagtctatccttaccagacccatattacattcttcctatcttatcatca
ctcttgttattatcaaataatgaattaacattattaatagataaaaaaatcaatgaaaat
aataaacaatcaaatttaaataaccaagaagaaacagagtttcaaaaaaatatgaaaaaa
attacaaaacttgctatgcgcttattctatttatcctctgtacttttctttaaatccatg
ccatctggactttttatatattttattacaaatacattttttcaattattcataacacaa
atatgtaaaattaaaattatagaaaatttccttgacctaccacccttacattcgaaggga
tttataacgagtactaacacatcacaacagcaaacaacttcacaaaaaaaaataatacac
atgaatgatttaatcaaaaggaaaaaataa

DBGET integrated database retrieval system