KEGG   Plasmodium falciparum 3D7: MAL8P1.16Help
Entry
MAL8P1.16         CDS       T00095                                 

Gene name
ROM3
Definition
(RefSeq) rhomboid protease ROM3, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1211764..1211888,1211976..1212104,1212265..1212705,1212824..1212932)
Genome map
AA seq 267 aa AA seqDB search
MLRKDIESDEDGVVSSENIKLLERQTKNKYVDILFPGIELNKIIVWISFFQIIIYILSCL
LSENLSTPNVHILILLGATYGPLIKEGQYWRLVLPIFLHANLWHLIINILCILNLGLIIE
SKYKKSKFLLIYFLSGATGNILTTICNPCQLAVGASTSGFGLIGCSIFEIFLAWKNLTRK
AKNYYILNIFLFLLFFMFVSFSPSVDLFGHIGGFLCGAFLCCHYNKFIGYNIFQKFLYYS
FFFICSLIIIYLPVRLYIINMPCGMIY
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaaaagatattgaaagtgatgaagatggtgttgtatcatctgaaaatattaag
ctccttgaaagacagacaaaaaataaatacgtcgatattttatttcctgggatagaatta
aataaaattattgtatggataagtttttttcaaataattatttatattttaagttgttta
ttaagtgaaaacttgagcacaccaaatgttcatattttgatcttactcggggcaacttat
ggtcctttaattaaggaagggcaatattggagacttgtgctaccgattttcttacatgcc
aatttatggcatttgattataaatattttgtgtatcctaaatttaggtttaataattgaa
agtaaatataagaagtcaaaattcttattaatatattttttatctggagcaacaggaaat
attctcacaactatttgtaatccttgtcagctagctgtaggagcatcaactagtgggttt
ggattaattggctgttcaatatttgaaatatttttagcttggaagaatttaacaagaaag
gctaagaattattatattcttaatatttttttatttctattattttttatgtttgttagc
ttctctccttcagttgatctttttggtcatataggtggattcctttgtggagccttttta
tgttgtcattataataaattcataggatacaatatttttcaaaagtttctatattatagc
tttttttttatttgctcattaattattatttacttgcctgtaagattatacattattaat
atgccatgtggaatgatctattaa

DBGET integrated database retrieval system