KEGG   Plasmodium falciparum 3D7: MAL8P1.17Help
Entry
MAL8P1.17         CDS       T00095                                 

Gene name
PfPDI-8
Definition
(RefSeq) protein disulfide isomerase
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MAL8P1.17 (PfPDI-8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA Calsequestrin OST3_OST6 TraF Redoxin Glutaredoxin Thioredoxin_9 Thioredoxin_3 HyaE Thioredoxin_5 Es2
Motif
Other DBs
NCBI-GeneID: 2655362
NCBI-ProteinID: XP_002808883
PlasmoDB: MAL8P1.17
GeneDB: MAL8P1.17
UniProt: C0H4Y6
Position
8:complement(join(1207860..1209135,1209291..1209466))
Genome map
AA seq 483 aa AA seqDB search
MNRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFITKNDIVLVMFYAPWC
GHCKRLIPEYNEAANMLNEKKSEIKLVSIDATSENALAQEYGITGYPTLILFNKKNKINY
GGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVAFYLEYTSEDNDLYKKFNEVG
DKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFVTSESFPLFGEINTENYRF
YAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLLNIPEYAEHAKASLGLTEFP
GLAFQSNEGRYLLKNPKESLLNHNAIINFFKDVEAGKIEKSLKSEPIPEDDKNAPVKIVV
GNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYDSIIVAKMDGTLNETP
IKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHATNTPISIDGVPEFEDGTS
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaagtatttttcttccctttttttatttcttatttcttttgtgttcgaatca
tttgttcgttcgcatggtgacctttttaatcattttgtaactgatatacatgatggggaa
cttgataaattcataacaaagaatgatatagttttggttatgttttacgctccatggtgc
ggtcattgtaaaaggctaatcccagaatataatgaagctgcaaatatgttgaatgagaaa
aagagcgaaataaaattagtaagtattgatgctacttcagaaaatgctcttgctcaagaa
tatggaataacaggatatccaactttgattttatttaataaaaagaacaaaataaattat
ggaggcgggagaacagctcaatctattgttgattggttattacaaatgacaggtcccgta
tttagtcatgttgaagggaatattgaagatgtcttaaaagagaagaaaatcaatgtggct
ttttatttagaatatacttcagaagataatgatttatacaaaaaatttaatgaggttggg
gataaaaatagagaaattgcaaaatatttcgtaaagaaaaatgataaacataataaatta
ttttgttttagaacagatgaaaaaaaagtggaatatgatgaaaagacaccgctcgaagaa
tttgttacatctgaatcatttccattatttggagaaattaatacagaaaattatagattc
tatgctgaaagcccaaaagaattagtatgggtatgtgctacctatgaacaatataacgaa
attaaagaacatgtaagattagctgcacaagaattaagaaaaaaaactcatttcgttctc
ttaaatataccagaatatgctgaacatgctaaagcatcattaggattaacagaattccca
ggattagctttccaatcaaatgaaggaagatatttattaaagaacccaaaagaatcttta
ttaaaccacaatgctattatcaatttctttaaagatgtagaagctggaaaaatcgaaaaa
tctcttaaatcagaacccataccagaagatgataaaaatgcacccgtcaaaatagttgtt
ggtaactcttttgtagatgttgtcttgaaaagtgggaaagatgtactcattgaaatatat
gcaccatggtgtggtcactgtaaaaaattagaacccgtttatgaagacttaggaagaaaa
ttaaaaaaatatgattccattattgtagccaaaatggatggtacattaaatgaaacccca
ataaaagatttcgaatggtctggattcccaaccatcttctttgtcaaggctggttccaaa
atacctttgccatatgaaggagagagatcacttaaaggttttgtagatttcttgaataaa
cacgcaaccaacacgccaatatcaatagacggggtacctgaatttgaagacggcacatcc
gaggagttataa

DBGET integrated database retrieval system