KEGG   Plasmodium falciparum 3D7: MAL8P1.17Help
Entry
MAL8P1.17         CDS       T00095                                 

Gene name
PfPDI-8
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
pfa  Plasmodium falciparum 3D7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(1207860..1209135,1209291..1209466))
Genome map
AA seq 483 aa AA seqDB search
MNRKYFSSLFLFLISFVFESFVRSHGDLFNHFVTDIHDGELDKFITKNDIVLVMFYAPWC
GHCKRLIPEYNEAANMLNEKKSEIKLVSIDATSENALAQEYGITGYPTLILFNKKNKINY
GGGRTAQSIVDWLLQMTGPVFSHVEGNIEDVLKEKKINVAFYLEYTSEDNDLYKKFNEVG
DKNREIAKYFVKKNDKHNKLFCFRTDEKKVEYDEKTPLEEFVTSESFPLFGEINTENYRF
YAESPKELVWVCATYEQYNEIKEHVRLAAQELRKKTHFVLLNIPEYAEHAKASLGLTEFP
GLAFQSNEGRYLLKNPKESLLNHNAIINFFKDVEAGKIEKSLKSEPIPEDDKNAPVKIVV
GNSFVDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEDLGRKLKKYDSIIVAKMDGTLNETP
IKDFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHATNTPISIDGVPEFEDGTS
EEL
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaaagtatttttcttccctttttttatttcttatttcttttgtgttcgaatca
tttgttcgttcgcatggtgacctttttaatcattttgtaactgatatacatgatggggaa
cttgataaattcataacaaagaatgatatagttttggttatgttttacgctccatggtgc
ggtcattgtaaaaggctaatcccagaatataatgaagctgcaaatatgttgaatgagaaa
aagagcgaaataaaattagtaagtattgatgctacttcagaaaatgctcttgctcaagaa
tatggaataacaggatatccaactttgattttatttaataaaaagaacaaaataaattat
ggaggcgggagaacagctcaatctattgttgattggttattacaaatgacaggtcccgta
tttagtcatgttgaagggaatattgaagatgtcttaaaagagaagaaaatcaatgtggct
ttttatttagaatatacttcagaagataatgatttatacaaaaaatttaatgaggttggg
gataaaaatagagaaattgcaaaatatttcgtaaagaaaaatgataaacataataaatta
ttttgttttagaacagatgaaaaaaaagtggaatatgatgaaaagacaccgctcgaagaa
tttgttacatctgaatcatttccattatttggagaaattaatacagaaaattatagattc
tatgctgaaagcccaaaagaattagtatgggtatgtgctacctatgaacaatataacgaa
attaaagaacatgtaagattagctgcacaagaattaagaaaaaaaactcatttcgttctc
ttaaatataccagaatatgctgaacatgctaaagcatcattaggattaacagaattccca
ggattagctttccaatcaaatgaaggaagatatttattaaagaacccaaaagaatcttta
ttaaaccacaatgctattatcaatttctttaaagatgtagaagctggaaaaatcgaaaaa
tctcttaaatcagaacccataccagaagatgataaaaatgcacccgtcaaaatagttgtt
ggtaactcttttgtagatgttgtcttgaaaagtgggaaagatgtactcattgaaatatat
gcaccatggtgtggtcactgtaaaaaattagaacccgtttatgaagacttaggaagaaaa
ttaaaaaaatatgattccattattgtagccaaaatggatggtacattaaatgaaacccca
ataaaagatttcgaatggtctggattcccaaccatcttctttgtcaaggctggttccaaa
atacctttgccatatgaaggagagagatcacttaaaggttttgtagatttcttgaataaa
cacgcaaccaacacgccaatatcaatagacggggtacctgaatttgaagacggcacatcc
gaggagttataa

DBGET integrated database retrieval system