KEGG   Plasmodium falciparum 3D7: MAL8P1.20Help
Entry
MAL8P1.20         CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1165727..1165741,1165833..1165871,1166073..1168277)
Genome map
AA seq 752 aa AA seqDB search
MNSIKGSAKELFKHLKDELIQQNNTYSYDEDSNIISSTHSNDEEYYEDIKYLKKEQLKAY
ICKLRKELRNYKMRELHLLSEIKYLKRKVTRLNDLIEHDNILLRGNRKGSNSLKYYDDNY
SNKSYEQGGEISSCYMKTSEGKYLIKKNRFLYDSKNTIHNFHKKHRDFSINSINESINNC
RRNRSMSNTLLYKQSKQQNKQQHQRQGGKGWGLELGREEDSSNMLHNITSKSVYSLKNIN
GYNNDNINTILYRNKYNSNNSTSSYYINNNNNNMKRYNSSTSLLCSNKNINLSRKSLISN
TMHNNKTNNIFSSNRSLASFSKYELKQHLISNSKHKRDNLLTNKINHNITRDIQNYHKTR
QRILSNNNISEKSTGTLLNKLSTLNNKNKHGQKILPKNNINIKCNIMNHKGNNNPNECPS
NIITKPISNDKEKKKKKKKKKKKKNCYEDMFHFKHHQNILNKKYTSSYEYTKNKTKQNKE
NMINKNVKSISQKKENNIQSVEATQHNLQQIKNDSKIQNNNNMSDENNSFVLDPLVSDEN
KHQKEIKDVKPINDDVNKTSGRLNEQTNLQNVTSEKNMTYTSKSNHDSFISSENERVKEY
LNKCRLKQKNKINTEQKNKINTEQKKSEKQPSLNTITKESRNSKLIGLKQHIDIEIKENF
RKELDELKKRNNNIILKPSNFYNFPMDTSSSNTSDNSDNNICHKKENINDMKCTKYNVKT
NPLKESTLLNISFNCIDKRITNLQNYLKNTKR
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtataaagggttctgctaaggaattgtttaaacatttaaaagacgagctcata
caacaaaataatacttactcatatgatgaggactctaatataatttcttctactcattcc
aatgatgaagaatactatgaggacataaaatatttaaaaaaagaacaattaaaagcatat
atatgtaaattgagaaaggaactaagaaattataaaatgagagaattacatttacttagt
gaaataaaatatttaaaaagaaaagtcacaagactcaatgatttgatagaacatgataat
atattattaagagggaatagaaaaggtagtaattctttaaaatattatgatgataactat
agtaataaatcgtatgaacaaggtggagaaatatcttcttgttatatgaaaacatcagaa
ggaaaatatttaataaaaaagaacaggtttttatatgatagtaaaaatacaattcataat
tttcataaaaaacatagagatttttctattaatagtataaatgaaagtataaataattgt
cgaagaaatagatctatgtcgaatacattattatataaacaaagcaaacaacaaaacaaa
caacaacatcaacgtcaaggaggaaaaggttggggattagaattaggaagggaagaagac
agtagtaatatgttacataatattacaagtaaatctgtttattctttaaaaaatataaat
ggatataataatgataatattaatacaattctttataggaataagtataacagtaataat
tcaacatcatcttattatattaataataataataataatatgaaaagatataatagttca
acatctttactatgtagtaataaaaatataaacttatcaagaaaaagtcttataagtaat
acaatgcataataataaaacaaataatattttttcatcaaatagaagccttgcctctttt
tcaaaatatgaattgaaacagcaccttattagtaacagtaaacataaaagagataatttg
ttaacaaataaaattaaccataacataacaagagatatacaaaattatcataagactcga
caaaggattttatcaaataataatatatctgaaaaatccacaggcacattgttaaataaa
ttgtctacattgaataataaaaataaacatggtcaaaaaatattaccaaagaataatatt
aatataaaatgtaatatcatgaatcataaaggtaataacaatccaaatgaatgccctagt
aatataataacaaaacctatttctaatgataaagaaaaaaaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaaattgttatgaggacatgtttcattttaaacaccatcaaaatatttta
aataaaaaatatacatcatcttatgaatatacaaaaaacaaaacaaaacaaaataaagaa
aatatgataaataaaaacgtaaaaagcatatcacaaaaaaaagaaaataatattcaatcc
gtagaagctacacaacataatttgcaacaaataaaaaatgactcaaaaatccaaaacaat
aataatatgtcagatgaaaataattcatttgtgttggatccattggtatctgatgagaat
aagcaccaaaaggaaataaaagatgttaaacctataaatgatgatgttaataaaacatca
ggacgtttaaatgaacaaacgaatctacaaaatgttacaagcgaaaagaatatgacatac
acttcaaagagtaaccatgatagttttatatcttcagaaaatgaaagggttaaagaatac
ttaaataaatgtagattaaaacaaaaaaataaaataaatactgaacaaaaaaataaaata
aatactgaacaaaaaaaaagtgagaaacaaccatctttaaataccataacaaaagaaagt
aggaatagcaaattgatcggcttaaaacaacatatagacatagaaataaaggaaaatttt
agaaaagaactggatgaattaaaaaaaagaaataataatattattttaaaaccttccaac
ttttataattttcctatggatactagtagtagtaatactagtgataattctgataataat
atatgccataaaaaggaaaatattaacgatatgaaatgtactaagtataatgtaaaaaca
aatcctttaaaggaatcaacactattaaatatatcctttaattgtattgataaaaggata
accaatttacaaaattatttgaaaaatacaaagaggtaa

DBGET integrated database retrieval system