KEGG   Plasmodium falciparum 3D7: MAL8P1.205Help
Entry
MAL8P1.205        CDS       T00095                                 

Definition
(RefSeq) Plasmodium exported protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1340730..1340813,1340996..1343377)
Genome map
AA seq 821 aa AA seqDB search
MEYIHILRKLLFSYFSVVLLGIIYEIPVDLSVYDETEQSGVKYLNICSRKLSETEKDHIP
SLRCHELKYKSKDEINEESCINREDFKEFDIKDENEEVKMDEYENDEEETYEEEEEYIDE
KNENYENKEDISDREDLSDMENNNDKDDLSDMENNNDKDDLSDMENNNDKDDLSDMENNN
DKEDLSDKEDLSDKEDLSDKEDLSDREDLSDKEDLSDKEDLSDKEDLSDKEDLSDREDLC
DKENLSDKEDLSDMEYSNDKDDFSDMEYSNDKDDFSDKEDINDREDFSDKENSYNEEYNN
NGEEENFKREKYDKTIINNLYYSKWNVGVENDENKWIDENHELMDKWSLIKNCTNGKWID
CEKIHDEYRKKKNYDDSMWENIKQDDEVDEWDLGHEKEKDKWVFVEGYDYTNSVIEEEND
DELKNIESDDEQKWDFSEDEEDKSDSVEERNDVEHQKKIEEEKDDENSNSGKWDFIRNKE
NGWGILENQKERMNFSEKDENRINLIELYFDNVYNYVDRKYENEDLISSEPEKVNVMKQE
EEYNKNDDIDMNKYSKKDIGMFYLYQEELKNEGDKEELINKRDNKRNKENDEDITIENDE
QILNGNYEKEGKSKELKGENDCINESSENIIKKKTDKKEDINNNNNTTENNENIDYNKFI
KDLKEDKVDNVFHGFGSYPLKKDILGLWWEALSIIKLGFEIITRDFKSYMKTYLDKYEYN
HRSTYEYPFIWSYIQSTWGRCILNLGMEVASEQKEFSRNFYHLLNKTANLEDITNFIYSG
MMYFEKLRKRLLYKYKHTFRSKIKNLPDNALNIKFYQGKLI
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggaatacatacatattttaagaaaacttcttttcagctatttttctgtggttctttta
ggaattatatatgaaattccagtagatttatctgtgtatgatgaaactgaacaatcagga
gtaaaatatttaaatatttgttcaagaaaattatctgaaacagaaaaagatcacatccca
tcattaagatgtcatgaattaaagtataaatcgaaagatgaaataaatgaagaaagttgt
attaatcgtgaggattttaaagagtttgatattaaggatgaaaatgaagaagttaaaatg
gatgaatatgaaaacgatgaggaagaaacatatgaagaagaagaagaatatattgatgag
aaaaatgaaaattatgaaaataaagaggatattagtgatagggaagatttaagtgatatg
gaaaataataatgataaggatgatttaagtgatatggaaaataataatgataaggatgat
ttaagtgatatggaaaataataatgataaggatgatttaagtgatatggaaaataataat
gataaggaagatttaagtgataaggaagatttaagtgataaggaagatttaagtgataag
gaagatttaagtgatagggaagatttaagtgataaggaagatttaagtgataaggaagat
ttaagtgataaggaagatttaagtgataaggaagatttaagtgatagggaagatttatgt
gataaggaaaatttaagtgataaggaggatttaagtgatatggaatatagtaatgataag
gatgattttagtgatatggaatatagtaatgataaggatgattttagtgataaggaagat
attaatgatagggaagattttagtgataaggagaatagttataatgaagaatataataat
aatggagaagaggaaaattttaagagagagaaatatgataaaacaattattaataattta
tattatagtaaatggaatgtgggtgtagaaaatgatgagaataaatggatagatgaaaac
catgaattaatggataagtggagtttgattaaaaattgtacaaatgggaaatggatagat
tgtgaaaaaattcatgatgaatatagaaaaaaaaaaaattacgatgattcaatgtgggaa
aatattaaacaggacgacgaagttgatgaatgggatttaggacatgaaaaagaaaaagat
aaatgggtatttgtagagggatatgactatactaattcagttatagaagaagaaaatgac
gatgaattaaaaaatattgaatcagatgatgaacagaaatgggatttctcagaagatgaa
gaagacaaatctgattctgtagaagagagaaatgatgtcgaacaccaaaaaaaaatcgaa
gaagaaaaagatgatgaaaacagtaattctggtaaatgggattttataaggaataaagaa
aatggatggggtattttggaaaatcaaaaagaaagaatgaatttttcagagaaagatgaa
aatagaattaatttaattgaattatattttgataatgtttataattatgtagatagaaaa
tatgaaaacgaggatttgatatcaagtgaaccagaaaaagtaaatgttatgaaacaagag
gaggaatataataaaaatgatgatatagatatgaataaatatagtaaaaaagacatagga
atgttttatttgtaccaagaagaactgaaaaacgaaggtgataaggaagaattgataaat
aagagagataacaaaaggaataaagaaaatgatgaagacattaccatagaaaatgatgaa
caaattcttaacggaaattatgaaaaagaaggaaaatcaaaggaacttaaaggagaaaat
gattgtattaatgaatcatctgaaaatattattaaaaaaaaaacagataaaaaagaggat
attaataataataataatactacagagaataatgaaaatatagattataataaatttata
aaagatttaaaagaagataaggttgacaatgtttttcatggttttggaagttatccacta
aagaaagatatccttggtttatggtgggaagcacttagtataattaaattaggttttgaa
ataataacaagagattttaagagttatatgaaaacttatttagataaatatgaatataat
catagatcaacatatgaatatccttttatatggagttatattcaatcaacttggggaaga
tgcatacttaatcttggaatggaagtagcttctgaacaaaaagaattttctagaaatttc
tatcatttacttaataaaacagccaatcttgaggatattacaaattttatttattctggg
atgatgtattttgaaaaattaagaaagcgcttattatataaatataagcatacgttccgt
agtaaaattaagaatctaccagataatgctttaaatataaaattttaccaaggtaaactt
atttag

DBGET integrated database retrieval system