KEGG   Plasmodium falciparum 3D7: MAL8P1.207Help
Entry
MAL8P1.207        CDS       T00095                                 

Gene name
VAR
Definition
(RefSeq) erythrocyte membrane protein 1, PfEMP1
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1349128..1358568,1359306..1360526)
Genome map
AA seq 3553 aa AA seqDB search
MGNASSSEGEAKTPSLTESHNSARNILEGYAESIKEQASKDAKIHGHHLKGDLAKAVFRH
PFSAYRPNYGNPCELDYRFHTNVWHRNAEDRNPCLFSRAKRFSNEGEAECNGGIITGNKG
ECGACAPYRRRHICDYNLHHINENNIRNTHDLLGNLLVMARSEGESIVKSHEYTGYGIYK
SGICTSLARSFADIGDIIRGKDLYRRDSRTDKLEENLRKIFANIYKELKNGKKWAEAKEY
YQDDGTGNYYKLREAWWALNRKDVWKALTCSAPRDAQYFIKSSVRDQTFSNDYCGHGEHE
VLTNLDYVPQFLRWFEEWAEEFCRIKKIKLGKVKEACRDDSKKLYCSHNGYDCTKTIRNK
DILSDNPKCTGCSVKCKVYELWLRNQRNEFEKQKKKYYKEIQTYTSKDAKTDSNINNEYY
KEFYDKLKNEGYETLNKFIKLLNEGRYCKEKISGERNIDFTMTGDKDAFYRSDYCQICPE
CGVQCSGTTCTPKKVIHPNCKDKETYEPGDAKTTDITVLYSGDEEGDIAQKLQDFCNDKN
KENDENYEKWQCYYKSSEINKCQMTPSSHKVPKHGYIMSFYAFFDLWVKNLLIDSINWKN
DLTNCINNTNVTDCKNDCNTNCKCFENWAKTKENEWKKVKTIYKNENGNTNNYYKKLNNH
FQGYFFHVMKELNKEEKWYKLMEDLKEKIDSSNLKNGTKDSEGAIKVLFDHLKDIAERCI
DNNSKDSCPPSVDTKTNPCAKPPGSKPTKSVKQLAEHMQQKAQKLLGTRGGESKLKGDAT
RGTYNLGGQGNTLNGDICKITKNHTNDSRPNGEPCTGKDKVKNGFRLKIGTPWTNIVQKK
KKKSYKDFYLPPRRQHMCTSNLENLSTSSKGLSNGSFASHSLLGDVLLAAKFEAQKIILV
YKNKNNINIRKRITDPNDQATVCRAIRYSFADLGDIIRGKDMWNINSDAKDLQDRLEKIF
KTINEKLPNEIQKRYTNRENKHLDLRSDWWEANRHQVWRAMKCATKGISNNNCNGIPIED
YIPQRLRWMTEWAEWYCKKQSQEYEKLEEKCGMCTGKGQGDGKDCTQKDKECSPCKKACD
AYKKEIEKWEKQWKTVSAIYQILYAKARIVASNGGPGYYNTEVQKKDRSVYDFLYELHLQ
NGGKKGPPPATHPYKSVNTRDKRDATDDTTPTVYSTAAGYVHQEAHIGDCKEQHVFCDNN
GNKEKYAFKNPPNVYVEACKCMTREAPPPPTTPSTPNPCAETGGVHTIKTVTDVAKILQG
EANETMLKNSSNGNDKDESKLKGKAEEGDYSRGGTPSDFNNNLCGITQKHSNAHNDSQQP
CYGKDQKRFNVGTEWSFKDNHRKRTHPEAYMPPRREHICTSNLEYLIHKRKKPIIEGDPN
KIIHSLLGDVLLAAKYEAENIKKLYEENNNRKDQEGICRAMKYSFADIGDIIRGKDMWIE
NNDAKRLQTNLKEIFTKIKEKTGGTTYNEDNDPYLKLRADWWEANRAKVWKAMKCKTNGV
DITCDSDHTPLDDYIPQRLRWMTEWAEWYCKAQSQEYKKLEEKCSQCKSKGKGGNECYRE
TKECNDCKQACEEYKRKIKTWADQWKVISNKYEDLYKKAQNPTNAVLKDNKDEKDKNVID
FLTQLQKANNGEKTGVHTVYSTAAGYIHQEARTRECQEQREFCDKKNGIDNTSYAFKDPP
HGYATACDCINRSQTEEPKKKEENVESACKIVEEVLSKPRDKTTGGIDHCNPKYYPRKEN
YPGWNCTPGQFKSGHAGACMPPRRIKLCVINLQYLNEKKSPEELRKAFIQCAAIETYWLW
QKYKKDKNGGVAQAKLNSGTIPDDFKRQMFYTFGDYRDLCLDTDISSKADTSTGVGKVKI
NIDSVFQKIDITNVEQRKPWWGKNAEAIWDGMLCALSYNTTNKNMDYNAHTKLNPTYGYN
AIKSELEDFVNRPQFLRWFTEWSDEFCTERSIKIKELETKCNDCTVSESGTSDATGNKTC
DDKDKCDECKRACTTYKTWLKNWKTQYKTQSKKYFDDKRKELYKSIDDVASSTQAYQYLH
AQLKKLCGNADCKCMDGESKETTGQPDNSHDSHMPASLDDEPEEVNGKCNCKVKHRPQPP
LALPPPAPSGPPAEDQIEHDNRGRSERGDQGPLPARPPPPPQAAQPPQPKPKRTGEGLGR
NLPPADRNTNLSDSEEEDDEDDDEVQEEEETPPSEAEEGEGHVETEEETKPVKEKTEGAG
ATEVTKQGSAPTATTPTVEDICATVAKALKGDKSLNAACALKYGKNNSRLGWKCIPTSGD
KTDTSENGAPRRARSAHGGKSDSEKGSICVPPRRRRLYIKKIVDWAESQSKTVTSVNGDG
NGSQEVVSVNGASESGGSGSGTESQASDVSQGNGASTSPQVALLHAFVKSAAIETFFAWH
KYKVDKEIEEKEKQAAQNHLVQRKTSENPQKKLEGGEIPEDFKRQMFYTLGDYRDILVGD
KTMIEALEKSGDTKIEDISEKIPKILDGENNKAAGGGPKQPNSGKTPQEWWKENAKHIWH
GMICALTYNTDSNGKDKKIQQVKATDNTDLFQKLKKDNDYETVSFGASGTGAKSNDDTKL
KNFVVRPTYFRWLEEWGEEFCRKQKHKLYIIKKDCRDNKFCSGDGLRCDEKVPDKKDIFK
HFDCPSCARHCRSYRKWIERKKTEYEKQESAYSKQKSNYVNGSNGDGGNNNDKEFYTKLE
TCTKATNFLESLKGQCIGNNNGGTDIKFSNTNITFGSAEDCKPCSEFKVNCENGSCGSAK
QKDCPNNTITSQNIKGLTDQVDMRVSDNTESGFEGDLGICQGAGIFKGIRKDEWKCGDFC
GIDICTLEKTNNGKESDKKYIIMKEFVKRWLEYFFEDYNRIQKKLKTCKENGKGSTCIRS
CVDEWIKLKKDEWQKINSNYLDQNTKENPEGNNLSSFLEDGPFKNEVDKAIKPCGNLTDF
KKSKKCNGTSRSGNSEESTKYDGVICLLDNLKNIIKTCQNVPSGKPDTPCQKSPAPVGDD
DDPLEEENPVTQPNICPQTSVEEKKKEEEEKCDEKEEEEEKEEEKDKGDEEVKEEEKDKG
DEEEEAEEEEEEEEETDSHIYEDYSDSDAEEDDEDEAVTESLSPSESQPKRLLREFPSPE
LKNAMLFSTILWMVGIGFAAFTYFFLKKKPKSPVDLLRVLDIHKGDYGTPTPKSKNRYIP
YVSDTYKGKTYLYVEGDTDEEKYMFLSDTTDITSSESEYEELDINDIYVPGSPKYKTLIE
VVLEPSKSDGNTPGKGDGNTLGDDMVPTTNTFTDEEWNELKQDFVSQYIQSRLPMDVPQY
DVSTESPMNIGGNVLDDGMDEKPFITSIHDRDLNSGEEISYNIHMSTNTNNDIPKYVSNN
VYSGIDLINDTLSDNKHIDIYDEVLKRKENELFGTNYKKNTSNNSVAKNTNSDPIMNQLD
LLHKWLDRHRDICENWGKKEDILNKLNEQWNKDNDGGDIPNDNKKLNTDVSIQIDMDETK
GKKEFSNMDTILDDMEDDIYYDVNDENPSVDDIPMDHNKVDVPKKVHVEMKILNNTSNGS
LEQQFPISDVWNI
NT seq 10662 nt NT seq  +upstreamnt  +downstreamnt
atggggaatgcatcatcatcagagggggaggctaaaacccctagtttaacagaaagtcac
aacagtgcaagaaatattttggaaggttatgccgaaagtataaaggaacaggcatcaaaa
gatgcaaaaatacatggacatcatttgaaaggagatttggcgaaagcagtatttcgtcat
ccattttctgcatatagacctaactatggaaatccgtgcgaacttgattataggtttcat
actaatgtatggcatcgtaacgcagaagatagaaatccttgtctttttagtcgtgcaaaa
cgtttttcaaatgaaggtgaagcagaatgtaatggtggtataataactggtaataaaggt
gaatgtggggcatgtgcaccgtataggagaagacatatatgtgactataatttgcaccat
ataaacgaaaataatataaggaatactcatgatttattggggaatttgttagttatggca
aggagtgaaggtgaatctattgtgaaaagtcatgaatatacaggttatggtatatacaaa
tcaggtatatgtacttctcttgctcgcagttttgcagatataggagatattattcgagga
aaagatctgtatcgtcgtgatagtagaacagataaattagaagagaatttaagaaaaatt
ttcgcgaatatatataaagaattgaagaatgggaagaagtgggcggaagcaaaagagtac
taccaagatgatggaactggaaattattataaattaagggaagcttggtgggcacttaac
agaaaagatgtgtggaaagcattaacatgtagtgcgccaagggatgctcaatatttcata
aaatcaagcgtcagggatcaaacattttcaaatgattattgtggccatggtgaacatgag
gttcttacaaatttagattatgtccctcaatttttacgatggtttgaagaatgggcagaa
gagttttgtagaataaaaaaaataaaattaggaaaggttaaggaagcatgtcgtgatgac
tcaaaaaaattatattgtagtcataatggatatgactgtacgaaaactattcgaaataaa
gatattttgtctgataatcctaaatgtactgggtgttctgttaaatgcaaagtttatgaa
ctttggttaaggaatcaacgaaatgaatttgaaaaacaaaaaaaaaaatattataaggaa
atacagacatatacatcgaaggacgctaaaactgatagtaatattaataacgaatattat
aaggaattttatgacaaacttaaaaatgagggctatgaaacattgaacaaatttataaaa
ttactaaatgaaggaaggtattgtaaagaaaaaatatcaggagaaaggaatattgatttt
actatgactggtgataaagacgcgttttatcgctcagactattgccaaatatgtcctgaa
tgtggagtccaatgtagcggtacaacatgcacaccaaaaaaagtgatacatccgaattgc
aaagataaagaaacttatgagcctggtgatgcaaaaaccactgatattactgtcctttat
agtggtgatgaagaaggtgatattgcacaaaaattacaagatttttgtaatgataaaaat
aaagaaaatgatgaaaactatgaaaaatggcaatgctattataaaagtagtgagattaat
aaatgtcaaatgacaccatcatcacacaaagttccaaaacatggttacattatgtcattt
tatgctttttttgatttgtgggttaagaatttattaatagatagtataaattggaagaac
gatcttacgaattgtataaataatactaatgttacggattgtaaaaatgattgtaacaca
aattgtaaatgttttgaaaattgggctaaaacaaaagaaaatgagtggaaaaaagtgaag
acgatatacaaaaatgaaaacggaaacacgaacaattattataaaaaacttaataaccat
tttcaaggttatttttttcacgttatgaaagagcttaacaaagaagaaaaatggtataaa
cttatggaagatttaaaagaaaaaattgattcttccaatttgaaaaatggtacgaaagat
tcagaaggcgcaataaaagtgttgttcgatcacttaaaagatatagctgaaagatgcata
gacaataattcaaaagattcatgtccaccttcagtggatacgaaaacaaacccctgtgct
aaacctcctggtagtaaacccactaaaagtgtaaaacaattagcggaacatatgcaacag
aaggcacaaaaacttttgggtactcgtggtggtgaaagtaaattgaagggggatgcaaca
agagggacgtataaccttggaggtcaaggaaacacgttgaatggcgatatatgtaaaata
acaaaaaatcataccaatgatagtcgtcctaatggtgaaccatgtacaggtaaagataaa
gttaaaaacgggtttcgcttgaaaataggaaccccgtggacaaatattgtacaaaaaaaa
aaaaaaaagtcatacaaagacttctatttacctcctcggcgtcaacatatgtgtacatca
aatttagaaaatttgagcacgagtagcaaaggacttagtaatggtagttttgctagtcac
tcattattaggtgatgtattgctcgcagcaaaatttgaagcacaaaagataatactagtg
tataaaaataagaataatataaatatcagaaaaagaataactgacccaaatgatcaagct
actgtatgtcgtgctatacgttacagtttcgccgatctaggagatattatacgaggaaaa
gacatgtggaatataaacagtgatgcaaaagatcttcaagatcgtttagaaaaaatattt
aaaaccattaatgaaaaacttcctaatgaaatccaaaaaagatatacgaaccgtgaaaat
aaacatttagatttacgttcagactggtgggaagctaatagacatcaagtttggagagct
atgaaatgtgcaacaaaaggcatcagcaataacaattgtaatggtatcccaatagaagat
tacatcccacaacgattaagatggatgacggaatgggccgaatggtattgcaaaaagcag
tcacaggaatatgagaagttggaggagaagtgtgggatgtgtacgggtaagggtcagggt
gatggtaaagattgtacacagaaggataaagaatgtagtccgtgcaagaaagcatgtgat
gcatataagaaggaaatagaaaaatgggaaaaacaatggaaaacagtatcagctatatac
caaatattatacgcaaaagcacgaattgttgctagtaatggcggtcctgggtattataat
acggaagtacagaagaaagaccgatccgtgtatgacttcttgtacgagttacatttacaa
aatggtggcaaaaaaggtcctcctcctgctacacatccttataaatctgttaacacacgt
gataaacgtgatgccactgatgatacaacacccactgtgtatagtactgctgcaggatat
gtacaccaagaagcacatattggtgattgtaaggaacaacacgttttttgtgataataac
ggcaacaaggagaagtatgcttttaagaatccaccaaatgtatatgttgaggcgtgtaag
tgtatgacgagggaggcaccaccaccaccaacaactccttctactccaaatccgtgtgct
gaaactggtggtgtacataccattaaaactgtgactgatgtcgcaaaaatattacagggg
gaggcaaatgaaacaatgctaaaaaatagttccaatggtaatgataaggatgagagtaaa
ttgaaaggtaaggcagaagaaggggattatagtcgtggaggtacgccaagtgacttcaac
aacaatttatgtggtataacacaaaagcattccaatgctcataatgattcacaacaacca
tgttatggaaaagatcaaaaaaggttcaatgtaggaacggaatggtcatttaaggataat
catagaaaacggacacaccctgaggcatatatgcctccaagaagggaacatatatgtaca
tcaaatttggaatatttaattcataagagaaaaaaaccaattatagaaggtgatcctaac
aagattattcattccttattgggcgatgtgttacttgcagcaaaatatgaagcagaaaac
ataaagaaactgtatgaagaaaataacaaccgaaaagatcaggaaggtatatgtcgagct
atgaaatatagttttgcagatataggggatattattcgaggaaaagatatgtggatagaa
aacaatgatgctaagagattacaaacaaatttgaaagaaatatttactaaaattaaagaa
aaaactggaggcaccacatataatgaagataacgatccgtatttaaaattacgtgcagat
tggtgggaagctaatagagccaaagtatggaaagcaatgaaatgtaaaacaaatggcgta
gatatcacttgtgatagtgatcatacaccattggatgattatatcccccaaagattaaga
tggatgactgaatgggcagaatggtattgtaaagcgcaatcacaggagtataagaagttg
gaggagaagtgtagtcaatgcaagagtaagggtaaaggtgggaatgagtgttacagagaa
acgaaggaatgtaacgattgcaagcaagcatgtgaagaatataaaaggaaaataaaaaca
tgggcagatcaatggaaggtaatatcaaataaatacgaggatttatacaaaaaagcccaa
aatcctactaatgctgttctcaaagataacaaagatgagaaagacaagaatgtgattgat
tttttgacacaattacaaaaagcaaataatggcgaaaaaactggtgtgcacaccgtgtat
tctactgctgcaggatatatacatcaagaggcacgtacacgtgaatgccaggaacaaagg
gagttttgtgataaaaaaaatggcattgacaacacaagttatgcttttaaggatccacct
catgggtatgctacagcgtgtgattgcataaataggtcgcaaacagaggagccgaagaaa
aaggaagaaaatgtagagagtgcgtgcaaaatagtggaagaagttctttcgaaaccacga
gataaaactacaggtggaatagatcattgtaatccaaagtattatccaagaaaagaaaat
tatcctggatggaattgtactccaggtcagtttaaatcaggtcatgctggagcatgtatg
cctccaagaagaataaaattatgtgtaattaatttacaatatttgaatgagaagaaatca
ccagaagaattgagaaaagcttttattcaatgcgctgcaatagaaacgtattggttatgg
caaaaatacaaaaaggataagaatggtggtgttgcacaagcaaaattaaatagtggtacc
atccctgatgactttaagcgtcaaatgttctatacgtttggagattatagagatttatgt
ttagatactgatatatcatcaaaagcagatacaagtacaggtgtaggtaaagtaaaaatt
aatatagattctgttttccaaaaaattgacataactaatgtcgaacaacgtaaaccttgg
tggggaaaaaacgcagaagctatttgggatggaatgttatgtgctttaagttataatact
acaaacaaaaatatggattacaatgcacacacaaaattaaatcccacgtacggctacaac
gccataaaatctgaactggaagactttgtgaacagacctcaattccttcgatggttcact
gaatggagtgacgaattttgtacagaacgtagtataaagatcaaggagttggaaacaaaa
tgtaacgattgtactgttagtgagagtggtactagtgatgctacgggtaataaaacatgt
gatgataaagataaatgtgacgagtgcaaaagagcatgtacaacatataaaacttggctt
aaaaattggaaaactcaatataaaacacaaagcaaaaaatattttgatgataaaagaaaa
gaactatataaaagtatcgatgacgtcgccagttctacacaagcctatcaatatttacat
gcacaattaaaaaaactttgtggtaatgctgattgcaagtgtatggatggtgagtccaaa
gaaacaaccggacagcctgataactcccacgattcccatatgcctgcatcattagatgat
gaacccgaagaagtgaatggaaagtgtaattgtaaagtgaaacatcgtccacaacctccg
ctagcacttccaccaccagcaccatcgggacctccagctgaagaccaaattgagcatgac
aatagaggacgatcggaacgtggtgaccaaggcccactaccagcgcgacctcctcctccc
ccacaagctgcacaaccaccacaaccaaaaccaaaacgcactggagaaggcctcggtcgt
aatctaccaccagctgacagaaataccaatctctccgattccgaagaagaagacgacgaa
gatgacgacgaagtccaggaggaggaggaaacgccaccgtcggaggcggaggaaggtgaa
ggacacgtcgagacagaggaggagacgaagccggtgaaggaaaagacggaaggggcgggg
gccacagaagtcacaaaacaggggtcggcaccaacggcaacaacaccaacagtagaagat
atttgcgccacagtggccaaagcacttaagggcgacaaaagtctcaatgccgcatgtgcc
ctcaaatatggcaaaaacaactcacgtttaggttggaaatgtataccaactagtggtgac
aaaacagacacaagtgagaatggtgccccacgtcgtgctcgtagtgcccatggtggtaaa
agtgatagtgaaaaaggttccatatgtgtgccgccgcgaagacgacgattatatataaaa
aagatagtagattgggcggaatcacagtcgaagacagtaacaagtgttaatggagatggt
aatgggtcacaggaagtagttagtgttaatggagctagtgagagtggtggtagtggtagt
ggtactgagtcacaggcgagtgatgtgtcacaaggtaacggcgcgtcgacatcgccacaa
gtggctctcctccacgcctttgtgaagtccgctgcaatagagacgttttttgcttggcat
aaatataaagtggataaagaaatagaggaaaaggaaaaacaggcagcacaaaatcatcta
gttcaacgtaaaacaagcgagaacccccaaaagaaattagaaggtggtgaaatacctgaa
gattttaagcgtcaaatgttctatactttaggagattatagggatattttagtgggggac
aagactatgattgaggcgttagaaaagagtggtgacacgaaaatagaagatatatcggaa
aaaataccaaaaattttagatggtgagaacaacaaagctgctggtggtggccccaaacaa
ccaaatagtggtaaaacaccacaagaatggtggaaagaaaacgcaaaacacatttggcat
ggaatgatatgtgctttaacatacaacacagacagtaatggaaaggacaaaaaaatacaa
caggttaaagctacggacaacacagatcttttccaaaaactgaaaaaagacaacgactac
gaaactgtgtcatttggtgctagtggtaccggcgccaaaagcaacgacgataccaaatta
aaaaattttgtggtacgccccacatattttcgttggttagaggaatggggagaagagttt
tgtcgaaaacaaaaacataagttatatataattaaaaaagattgtcgtgataataagttt
tgtagtggtgatggcttgcgttgtgacgaaaaagttccagataagaaagatatttttaag
catttcgattgtcccagttgtgccagacattgtagatcttatagaaaatggatagaaaga
aaaaaaacagaatatgagaaacaagaaagcgcatatagtaaacaaaaaagtaattacgta
aatggaagtaatggtgatggaggtaataataatgataaagaattttacacaaaactagaa
acgtgcactaaagcaacaaactttttagaatcattaaaaggacaatgtattggtaataat
aatggaggcactgacataaaatttagtaatacaaatataacatttggatctgcagaagat
tgtaaaccttgttctgaatttaaagtaaattgtgaaaatggtagttgtgggagtgctaag
caaaaggattgcccaaataatacgattacttcacaaaatattaaaggtcttactgaccaa
gtagatatgcgtgttagtgataacactgaaagtggatttgaaggtgatttaggcatttgt
cagggtgcaggtatatttaaaggtattagaaaagatgaatggaaatgtggtgatttctgt
ggtatagatatatgtactctggaaaaaaccaataatgggaaagaaagcgataaaaaatat
atcataatgaaagaattcgttaaaagatggctagaatatttttttgaagattataataga
attcaaaaaaaattaaagacatgtaaagaaaatggtaaaggatccacatgtataagaagt
tgtgtagatgaatggataaagctgaaaaaggatgaatggcaaaaaattaacagtaattac
cttgaccaaaatacaaaagaaaatcctgaaggtaataatttaagctcttttttggaggat
ggaccgtttaagaatgaggttgataaagctataaaaccttgtggtaatttaactgatttc
aagaagtcaaagaaatgtaatggcacttccagatcaggaaatagtgaagagagcacaaaa
tatgatggtgttatatgtttgcttgataatcttaaaaacataataaaaacttgtcaaaac
gtacctagtggcaaaccagatacaccgtgtcaaaaatcccccgcccccgttggagacgat
gatgatccccttgaagaggaaaacccagtaacacaaccgaacatttgtccgcaaacatca
gtggaagaaaaaaaaaaagaggaagaagaaaagtgtgatgaaaaggaggaagaagaagaa
aaagaggaggaaaaagataaaggagatgaggaagtaaaagaagaagaaaaagataaagga
gatgaggaagaagaagcagaagaagaagaagaagaagaagaggaaacagatagtcacatt
tatgaagactactctgattcagacgcagaggaagatgatgaagatgaagctgttacagaa
tccttatcaccttcagagtcacaaccaaaacgattgctacgagaatttccatcccccgaa
ttaaaaaatgccatgttattttctaccatcctctggatggtaggtatcggttttgcggcg
ttcacttatttttttctaaagaaaaaaccgaaatcacctgttgacctcttacgtgtactt
gacatccataaaggcgattatggaacacctaccccgaaatcaaaaaatagatatatcccc
tatgtgagtgatacatataaagggaaaacatacttatatgttgaaggagatacagacgaa
gagaaatatatgtttctgtctgatactactgatataacctcttccgaaagtgagtatgaa
gaattggatattaatgatatatatgtaccaggtagtcctaaatataaaacattgatagaa
gtagtattggaaccatcaaaaagtgatggtaacacaccaggtaagggtgatggtaacaca
ctaggtgatgatatggtacctaccacgaatacatttacagatgaggaatggaatgaactg
aaacaggattttgtatcacaatatatacaaagtagattaccaatggatgtaccacaatat
gatgtatcaacggagagtccaatgaatataggaggtaatgttttagatgatggtatggat
gaaaaaccttttattacttctattcatgatagggatttaaatagtggagaagaaattagt
tataatattcatatgagtactaacactaataatgatattccaaaatatgtatcaaataat
gtatattctggtatagatttaattaatgatacattaagtgataacaaacatattgatata
tatgatgaagtgctaaaaagaaaagaaaatgaattatttggaacaaattataagaaaaat
acatcaaacaatagtgtagcaaaaaatactaatagtgatccaattatgaaccaattagat
ttgttacataaatggttagatagacatagagatatatgtgaaaattgggggaaaaaagaa
gatattttgaataaattgaatgaacaatggaataaagataatgatggtggtgatatacca
aatgataacaaaaagttgaatacggatgtttcgatacaaatagatatggatgaaactaaa
ggaaagaaggaatttagtaatatggatactatcttggatgatatggaagatgatatatat
tatgatgtaaatgatgaaaacccatctgtagatgatatacctatggatcataataaagta
gatgtaccaaagaaagtacatgttgaaatgaaaatccttaataatacatctaatggatcg
ttggaacaacaatttcctatatcggatgtatggaatatataa

DBGET integrated database retrieval system