KEGG   Plasmodium falciparum 3D7: MAL8P1.21Help
Entry
MAL8P1.21         CDS       T00095                                 

Gene name
PfVAMP7
Definition
(RefSeq) SNARE protein, putative
  KO
K08515  
vesicle-associated membrane protein 7
Organism
pfa  Plasmodium falciparum 3D7
Pathway
SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    MAL8P1.21 (PfVAMP7)
Membrane trafficking [BR:pfa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    MAL8P1.21 (PfVAMP7)
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAL8P1.21 (PfVAMP7)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1158393..1159223)
Genome map
AA seq 276 aa AA seqDB search
MFILSDDDVAYSNSINSEEIEESDYENSEAHSRYYEETDEEESNNNDIDDEDLCLFKYVC
IGSLDDVDILLKYSLFNRDIDKSANFIVKKILIASKKKLNYCNKKILNWDNHIIYFIICT
DKKLALFLIGLDLKASFKNYAFEFLRKLEIYAKSNLFYDKNYVSSHVNPSKVHTIECFMK
TTIKNLNKCCKNEKLFAVKQKLNKINSVMNNHIDTLYKSRGNIKALQYKTEDMSKNTLNF
VQNTKKLKRIMFLKYWKTYFLCACFLIIGFKVYRSI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtttattctttcagatgatgatgttgcatattccaatagtataaacagtgaagagatt
gaagaaagcgattatgagaatagcgaggcacattcaagatattatgaagaaacagatgaa
gaagaaagtaataataatgatatagatgatgaagatttatgtttatttaaatatgtatgt
ataggttctttagatgatgtagatatattattaaaatatagtctttttaatagagatata
gataaatcagcaaattttattgtgaaaaaaatattaatcgcatccaaaaaaaaattaaat
tattgtaataaaaaaatattaaattgggataatcatataatatattttattatatgtaca
gataaaaaacttgcattatttttaataggtctagatttaaaagcatcatttaaaaattat
gcattcgaatttttaagaaaacttgaaatatatgctaagtctaatttattttatgataaa
aattatgtatcaagtcatgtaaacccatcaaaagttcatactattgaatgttttatgaaa
accacaattaaaaatttaaataaatgttgtaaaaatgaaaaactttttgctgttaaacaa
aaattaaataaaattaattcagttatgaataatcatatagataccttatacaaatccaga
ggaaatattaaagccttacaatataaaacggaggatatgtcaaaaaatactttaaatttt
gtacaaaacacgaaaaaattaaaaagaattatgttccttaaatactggaaaacttatttt
ctatgtgcttgctttttaatcataggatttaaggtatatagatccatttaa

DBGET integrated database retrieval system