KEGG   Plasmodium falciparum 3D7: MAL8P1.22Help
Entry
MAL8P1.22         CDS       T00095                                 

Gene name
di-trans
Definition
(RefSeq) dehydrodolichyl diphosphate synthetase, putative
  KO
K11778  
ditrans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.87]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Terpenoid backbone biosynthesis
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAL8P1.22 (di-trans)
Enzymes [BR:pfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.87  ditrans,polycis-polyprenyl diphosphate synthase [(2E,6E)-farnesyl diphosphate specific]
     MAL8P1.22 (di-trans)
Prenyltransferases [BR:pfa01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   MAL8P1.22 (di-trans)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(1149082..1149225,1149373..1149475,1149614..1149898,1150007..1150123,1150225..1150367,1150530..1150621,1150741..1150796,1150889..1150902))
Genome map
AA seq 317 aa AA seqDB search
MALNIIERFVTYVLRDRINIKHISIIMDGNRRFAKEKGLHTAIGHFMGSKTLIQIIEICI
KLNIKILSVFSFSLLNYNRSPEEIHFLFYLNLLVLINEDFFFKFIKDNKIKIKIIGNLSY
VNDSYRKIIYDIEEKTKNFNNIRLNIFFSYTSRNEMSLCSFNPNLYRDTYKNLLQEKNIY
SGTNILTDPIKEGYFDIPTQEEELKYPDHENENELKFDGKCLCREKVKYNEEQLEIVNYH
NKLLTSDLPPPNILIRTSGEQRLSDFMLYQISEFTEIYFINEYWPVFNFLQFIYIILHYT
LFQTTKWIFSYSNPCPH
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggccctgaatataatagaaagatttgtaacatatgtattaagggatagaataaatatt
aagcatatatccataattatggatgggaatagaagatttgccaaagaaaaaggattacac
actgctataggacattttatgggatctaaaacattaatacagataatagaaatatgtatt
aagttaaatataaaaattttatccgtcttttcattttctctacttaattataatagaagt
cctgaagaaattcattttttattttatttaaatttacttgtacttattaatgaggatttc
ttttttaaatttataaaagacaataaaattaagatcaaaattattggaaacttatcttat
gttaatgattcttacaggaaaattatttatgacatagaagaaaaaactaaaaattttaac
aatataaggttaaatatattcttttcatatacaagtagaaatgaaatgagtctttgttca
tttaatccaaatttatatagggacacctacaaaaatttattacaagaaaaaaatatttac
tctggtacgaatatattgactgatccgattaaagaaggatattttgatattcccacacaa
gaagaagaactaaaatatcctgatcatgaaaatgaaaatgaattaaaatttgatggaaaa
tgtctttgcagggaaaaagtaaaatacaatgaagagcaattagaaatcgttaattatcat
aataaattgcttacaagtgatttgcctccccctaatattttaataagaacatcaggtgaa
caaagactatccgattttatgttatatcagatatcagagtttaccgaaatttattttatt
aatgaatattggccagtatttaattttttacaatttatttatataatattacattatacc
ctttttcaaacaaccaagtggatattttcatactcgaatccttgtccacactaa

DBGET integrated database retrieval system