KEGG   Plasmodium falciparum 3D7: MAL8P1.25Help
Entry
MAL8P1.25         CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
Position
8:join(1104555..1104644,1104912..1106180)
Genome map
AA seq 452 aa AA seqDB search
MLKFFVKYLYTAIILDEEITTDIKIKEMLKDIKCQSLLPVSYASHQMYSFDKLTPHEIKS
DLKKTFGNFISSKIQVLKNKFKLYDIKNREKYNNEEGNDSDLIGDAYISSLEDEIKHLLE
QAENKRMLSKKIKSSYERAHKNLKKRRNVEDDGKMKNVLKQNLQHIDYLNKKSDYLEKKA
GELKNILERRGNENAKEGNDNDEKNIYNNEYHNNCSISKRGTLKFINSSNGLKHSIDNVN
GMINENGFTIFYKNKKKMTYFWSVLELPIKMIGSIEQCFYFIYKNNNQIFCADNKIKAYS
WMNSLSEASLCFHFGIKGVLINSNINNINKNDDMNNTNDENVKHSDFMNNISNGIKQGKK
NKQKKIDENSLTVDIKPEDTGTRIFVNDVEQKINKDVPGKDNVFNLNDIKKKMDDERKTP
QSENDEDQQGGYDKMEENEKEDTQMDNDDYEM
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagttttttgtcaaatatttatacaccgcaataatacttgatgaagaaataaca
acggatataaaaataaaggaaatgctgaaagatataaagtgtcaaagtttattgcccgta
tcttatgcttctcatcaaatgtattcttttgataaattgacacctcatgaaataaagagc
gacttgaaaaaaacgtttggtaattttattagtagtaagatccaagtattaaaaaataaa
ttcaaattatatgatataaaaaatagagagaaatataataatgaagaaggtaatgatagt
gatttaataggagatgcatatatatcttctttagaagatgagataaaacatttactggaa
caagcggaaaataaaaggatgttatctaaaaaaataaaatcatcttatgagagggcacat
aaaaatttaaaaaaaagaagaaatgtggaagatgatggaaagatgaaaaatgttttaaaa
caaaatttacaacatattgattatttgaataaaaaatcggattatttagaaaagaaagca
ggagaattaaaaaatattctggaacgaagaggtaatgaaaacgcgaaagaagggaatgat
aatgatgaaaaaaatatatataataatgaatatcataataattgttctatttcaaagagg
ggtactttaaaatttattaattcttcgaatggtttaaaacattctattgataatgttaat
ggtatgattaatgaaaatgggtttacaatattttataaaaataaaaaaaaaatgacatat
ttttggagtgttttagagttaccaattaaaatgataggaagtatagaacaatgtttttat
tttatttataaaaataataatcaaatattttgtgctgataacaaaataaaagcttattca
tggatgaatagtttaagtgaagcatcattgtgttttcattttggtataaaaggtgtttta
attaatagtaatataaataatattaataaaaatgacgatatgaataatacaaatgatgaa
aatgttaaacattctgattttatgaataatattagtaatggtataaaacaagggaaaaaa
aataaacaaaaaaaaattgatgagaattcattaacggttgatataaaacctgaggataca
ggcacacgtatttttgttaatgatgtggaacaaaaaataaacaaggacgtaccaggaaaa
gataatgtttttaatttgaatgatataaaaaagaaaatggatgacgaaaggaaaacgcct
caaagcgaaaatgatgaagatcaacaaggagggtatgataaaatggaagaaaatgaaaaa
gaagatactcaaatggacaatgacgattatgaaatgtaa

DBGET integrated database retrieval system