KEGG   Plasmodium falciparum 3D7: MAL8P1.25aHelp
Entry
MAL8P1.25a        CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1097495..1097534,1097724..1097810,1097972..1098127,1098246..1098300,1098414..1098435)
Genome map
AA seq 119 aa AA seqDB search
MQINKLEGKEKKAGICRRCFRGLFKSIKGPSITHSVLFGICGGLVYYGSYYFYRFLKITY
FDTQHVSNESRRRYMEKQMLFYNDFGYDLSMKYIGNLCKYYDPVALRLPFQPLDDKYRL
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgcaaataaataaattagaaggaaaagaaaagaaagcaggaatatgcagaagatgtttt
agagggttgtttaaaagtataaaaggaccaagcataacacatagtgttttatttggaata
tgtggaggtcttgtgtattatggatcatattatttttaccgctttttaaaaattacatat
tttgacactcaacatgtgtcgaatgaaagcagaaggagatatatggaaaaacaaatgtta
ttttataacgattttggatatgatttatctatgaaatatattggaaacctatgtaaatat
tatgacccagttgctttgcgattaccttttcaaccattagatgacaaatataggctttaa

DBGET integrated database retrieval system