KEGG   Plasmodium falciparum 3D7: MAL8P1.27Help
Entry
MAL8P1.27         CDS       T00095                                 

Definition
(RefSeq) translation initiation factor IF-3, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1094762..1094935,1095027..1095097,1095201..1095267,1095376..1095561)
Genome map
AA seq 165 aa AA seqDB search
MLLKGFFFFIICVFYILIFYNNNVNCFYIPKICCTKYFYLKETSDAPAYSDGHERYIQEK
KLKQLKHKMENKSVKQLRITPRIGMNDLLIKINSAKQFLLKRHRVKFILTLKGREYTNVE
NVKRIFSKISEELKSYGNSETMRQNGNIVSQLFNLKAKRKNEGGT
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaagggtttctttttttttataatatgtgtattttatatattgatattttat
aataacaatgttaactgtttttatatacccaaaatatgttgtacgaaatatttttattta
aaagaaacaagtgatgcccctgcttattcagatgggcatgagcgatatattcaggaaaaa
aagttgaagcagttgaaacacaagatggaaaataaatctgtaaaacaattaagaattaca
ccaagaattggtatgaatgatttactcattaaaataaattccgcaaagcagtttttatta
aaaagacatcgggttaaatttattttaaccttaaagggtagagaatatacaaatgtagaa
aatgtaaaaagaatattttccaagatatctgaagaattaaaaagttatggtaattcagaa
actatgcgccaaaatggaaatattgtatcacagctatttaatttaaaagctaaaaggaaa
aatgaaggtggaacatga

DBGET integrated database retrieval system