KEGG   Plasmodium falciparum 3D7: MAL8P1.29Help
Entry
MAL8P1.29         CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1087120..1092044,1092251..1092320)
Genome map
AA seq 1664 aa AA seqDB search
MTSNYKSYNVLDYNLRFIQDEKRNRERERADNKNKENISLSINSDMGNKIYLLETNAKSR
KVEKDEKYKNISSSNYMKDKTYVDKNLGVKDDMSNLSSIKYNIEINRNRNNNRNNNRNNN
SNSNSFIMDEKEKTNNRTIMLLKHKRKYDPDYNTSDEKNIKRKKINDIINKYKKKMIIPS
YEENDEKYSNKGSFNISDDDEMDNKSSNYNISGKNYSTENNDNKNNFHIRSLEKMDKINN
EMKEYSTKDSIDLRRVESISHGSKENNNIDKLKCHNLIRNKNSNLVNFDRNKRKENFIFL
HNYMKKKENGNKTNINSYDIENIHDEKKDKNEILNNLDINSYNEEKCLSYNNMKENDFNK
IGISKQPNVDSKERKYNKYEKDHNIYNDLSDDGKSIDRTNVYDNNSSSHNVSLSNLFNES
NFMLDEKKIRDKFKEVKLIEKSLERNNSEIYENELKEGETHKKDELNKLVLDMTIKDINE
KKKKVILYHKDYSENYERKSISSENIDIGPTNRSFLVDGNNTKDMTHINENNDRDKNNDN
INNDNIIINNDNNINNNNVYNVKESNEDIFYKANKLSEKIDNIVQNIRNIKKIKKSNSGN
YNIDANLSDGISNDEANLKNVTNSMDYTKLYYDDDKGENTKNTFKKSAYDKNKKLLIEND
TKLMIHGNNNQKEWIRNDEKYLLNGINNSPKDLDNKRSNIDIQVNNNNNNNNDTTFYDAM
EYSIGNDKEQYNKNVQEDHVIMGVESNKNNMQTNCSSSNNKNYINNDRWNHLKEKYFDMM
KPGVVDNIINIKENELVLQKNEKKKDIFNKSHGNEKIEPLKDFNNKNVKVTNILKNKVND
DIHEDVKSVNIGNEIDENRKIKKKENILNSINQEKDIGNKNIINKTSYSKKNLLSKSYAE
KPHLYNMKEKKKNNINVNKCKEKNPLFYSVDFSNQKKNDIDKRMCDDLLSPGIDDSIERK
IIYENIIKFSKRNVNNEHELVDTYSDGKKKKEKSNERLKEELDMIKNYYSEEKLKREEEY
KLRNEIQQKRKLYELKIRKDFEEKIRLRREENEKRLNEEKINKIQQDNGKKELPNGIPDG
KPNDMSSEENEKKHITYNNEKKNYDNIEKNYDNIEKKNYDNNDGNNNNYYYDELRNETYK
NNKKKKRKNLFEDYSSDGSYYKYMYRNLYEETCNNKMKNHFYDISDNLYLQECSDNFFHN
NKISSSSIYKSPSHSFDNELISLSKIKFDDFDYNYLNELHKSVSKTKERKRSNYSDFSED
QKKLKNCNLVKPRVILTNSEKSYEQKCGEHSKRGEEMNGEYEKGDIYKKNDIYKNSDMCE
DNNVHQKNDIYEDNNIHQKNDINERDDSHKKGDIYERNGFHEKNAVLKRNILNKNNNTGN
LHNKNVGNSQKGKNRSLDYHRRSNIQNFYEYKMNNNVDDNILNKLLTIKYENKIRNDSLS
IKEDNIHNTKEGSVHEEMCEEEEDFEEKYSEDIDIEDENISVKLNHNDSEYNKNNCKGVK
LIQNKSDFNNENMDELNVSPTHTEIDKEEKQNVLLISTKEKSRIIKVNEKVDISPIKQII
QEEKNEPNDNINMDINDDEDNEGKSKLKTSISSSENGIPKINILKNNENYIPLDIALNFV
MDNEKLKKNLQKEEKKDKGKKKTFVQWLMDERKRRLKNNLPIDI
NT seq 4995 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaattataaatcttacaatgttcttgattataatttaaggtttatccaagat
gaaaaaaggaatagggaaagagaaagagcagataataagaacaaggaaaacatatccttg
agtataaattcagatatgggaaacaaaatatatttattagaaacaaatgcaaaaagtcga
aaagttgaaaaggatgagaaatataagaatataagttcatcaaattatatgaaagataaa
acttatgttgataaaaatttgggtgtaaaagatgatatgtcaaatttaagctccataaaa
tataatatagaaataaatagaaatagaaataataatagaaataataatagaaataataat
agtaatagtaatagttttattatggatgaaaaggaaaaaactaataatagaacgattatg
ttattaaagcataagagaaaatatgacccagattataatacctcagatgaaaagaatata
aagagaaaaaaaataaatgatattattaataaatataaaaaaaaaatgataattccttca
tatgaagaaaatgatgaaaaatatagtaataaaggatcatttaatatttcagatgatgat
gagatggataataaaagtagtaattataatataagtggtaaaaattattctacagaaaat
aatgataacaaaaataattttcacataagatctttagaaaaaatggataagataaataat
gagatgaaagaatactcaactaaagattccattgatcttagaagggtagaatccatatca
catggatcaaaagaaaataataatattgataagttaaaatgtcataatttaataagaaat
aaaaattccaacctcgtaaattttgataggaataaaagaaaagaaaatttcattttctta
cacaattatatgaaaaaaaaggagaatggaaataagacaaatattaattcatatgatata
gaaaatatacatgatgaaaaaaaagataaaaatgaaatacttaataatttagatataaat
tcttataatgaagaaaaatgtttaagttataataatatgaaggaaaatgacttcaataaa
attggcatatctaaacaaccaaatgtagattctaaggagcgtaagtataataaatatgaa
aaagatcataatatatataatgatcttagtgatgatggaaaatctatagatcgtactaat
gtatatgataataattcaagttctcataatgtaagtttaagtaatttatttaatgaaagc
aatttcatgttagacgaaaaaaaaattagagataaatttaaagaagtcaaattaattgaa
aaatcacttgaaagaaataattcggaaatatatgaaaatgaattaaaagaaggggagact
cataaaaaggatgaattaaataaattggtattggatatgacaataaaagatattaatgaa
aaaaaaaaaaaagtaatattatatcataaagactattcagagaattatgaaagaaaatct
ataagcagtgaaaatattgatataggaccaacgaatagatcatttttagttgatggaaat
aatacaaaggatatgactcatataaatgaaaataatgatagggataaaaataatgacaat
attaataatgataatattattattaataatgataataatataaataataataatgtttat
aatgtaaaagaatcaaatgaagatatattttataaggctaataaattatctgaaaaaata
gacaacattgtacaaaatattagaaatatcaagaaaataaaaaagtcaaattctggaaat
tataatattgatgccaacctttcagatggtatatcgaatgatgaggcaaacctgaaaaat
gttacaaattctatggattatacgaaattatattatgatgatgataaaggagagaataca
aaaaatacttttaagaaaagtgcatatgataaaaataaaaaattattgatcgaaaatgat
acaaaattaatgatacatggaaataataatcaaaaggaatggataagaaatgatgagaaa
tatcttttgaatggtataaataatagtccaaaagatttagataataaaagatcaaacatt
gacatacaagttaataataataataataataataatgatacaacattttatgatgctatg
gaatattctataggtaatgataaagaacaatacaataaaaatgtacaagaagatcatgta
attatgggagttgaatcaaataaaaataatatgcaaacgaattgctcttcatctaataat
aaaaattatataaataatgatagatggaatcatttgaaagaaaaatatttcgacatgatg
aaaccaggtgttgtagataatattataaatattaaagaaaatgaacttgtattacagaaa
aatgaaaaaaaaaaagatatttttaataaatcacatggaaacgaaaagatagaaccatta
aaagattttaataataaaaatgttaaggttacaaatattttaaaaaataaagtaaatgat
gatatccatgaagatgttaaaagtgttaatattggaaatgaaatagatgaaaataggaaa
ataaaaaaaaaggaaaatatattaaatagtataaatcaagaaaaagatattggaaataaa
aatattattaataaaacgtcatattcaaaaaaaaaccttttatcaaaaagttatgcagaa
aaacctcatctatataatatgaaagaaaaaaagaaaaataatattaatgtgaacaaatgt
aaggaaaaaaatcctttattctattctgttgatttctcaaaccaaaaaaaaaatgatata
gataagcgaatgtgtgatgatttattatctccaggtattgatgattcgattgaaagaaaa
ataatatatgaaaatataataaaattttccaaaagaaatgtaaataatgaacatgaatta
gtagatacatattcagatggaaaaaaaaaaaaagaaaaatccaatgaacgactaaaagaa
gaattggatatgattaaaaattattatagtgaagagaaattaaaaagggaggaggaatat
aaactgagaaatgaaattcaacaaaaaagaaaattgtatgaattaaaaattcgaaaagat
tttgaggaaaaaataaggcttcgaagggaggaaaatgaaaaaaggctaaacgaagaaaaa
ataaataaaatacaacaagataatggaaaaaaggaattaccaaatggtataccagatggt
aaaccgaatgatatgtcaagtgaagaaaatgagaagaagcatattacttataataatgaa
aaaaaaaattatgataatattgaaaaaaattatgataatattgaaaaaaaaaattatgat
aataatgatggtaataataataattattattatgatgaattaagaaacgaaacttataag
aacaataaaaaaaagaaaagaaaaaacctatttgaagattattcaagtgatggaagttat
tataaatatatgtatcgtaatttatatgaagaaacgtgtaacaataaaatgaaaaatcat
ttttacgatataagtgataatttatatttacaggaatgttctgataacttttttcataat
aataaaatctcctcatcttctatttataaatcaccttcacatagttttgataacgaatta
atatcattaagtaaaataaaatttgatgattttgattacaattatttaaatgaactccac
aaatcggtatctaagacaaaagagagaaaaagaagtaattattctgattttagtgaagat
cagaaaaagttaaaaaattgcaacctagttaaacctagggttattttaacaaatagtgaa
aagagttatgaacaaaaatgtggtgaacactccaaaaggggcgaagaaatgaatggggaa
tatgaaaaaggtgatatatataaaaagaatgatatatataaaaatagtgatatgtgtgaa
gacaataatgtacaccaaaagaatgatatatacgaagataataatatacatcaaaagaat
gatataaacgaaagagatgattctcataaaaaaggagatatatatgaaaggaatggcttt
catgaaaaaaatgcagtattaaaaagaaatattctaaataagaacaacaatacaggaaat
cttcataataagaatgtcggcaattcacaaaaaggaaaaaaccgatcgcttgattatcat
cgtagaagtaacatacaaaatttttatgaatataagatgaataataacgttgatgataat
atattgaataaattgttaactataaaatatgaaaataaaataagaaatgatagtttaagc
ataaaagaggataacattcacaatactaaggagggtagtgtacatgaagagatgtgtgaa
gaggaagaagattttgaagagaaatattcagaagatattgatattgaggatgaaaacatt
tctgttaaactaaatcacaacgatagtgaatataataaaaataattgtaaaggtgtaaaa
ttaatacaaaacaaaagtgattttaataatgaaaatatggatgaattgaatgtatcacca
actcataccgaaattgataaagaagaaaaacagaatgtattgttaatttctacaaaagaa
aaaagtagaattataaaagtaaatgaaaaggttgatatatctccaataaaacaaataata
caagaagaaaaaaatgaaccaaatgataatataaacatggatattaatgatgatgaagat
aatgagggaaaaagtaaattgaaaacatccatatcatcttcagagaatggaataccaaaa
attaatattttaaaaaataatgaaaactatataccattagatattgctttaaattttgtg
atggataacgaaaagttgaagaaaaatttacaaaaggaagaaaaaaaagataaaggaaag
aagaaaacctttgttcagtggttaatggatgaaagaaaaagaagattaaaaaataactta
cccatagatatttaa

DBGET integrated database retrieval system