KEGG   Plasmodium falciparum 3D7: MAL8P1.3Help
Entry
MAL8P1.3          CDS       T00095                                 

Definition
(RefSeq) Plasmodium exported protein (hyp9), unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1308124..1308234,1308450..1308995)
Genome map
AA seq 218 aa AA seqDB search
MKSIINNRTFNKMNIFILFINILVIDLFCVSVEFFNKHCFYKTANENVKLASSLSDRLSR
SLALRSHNEVGQPVFNVLNVNLNTEIKKKDMITEVETEFEVLEVCAEEEDGENEIRITMK
TNLKPDMIKLRALNEEVTLKKWDFIMDDLAKCEYKKQKEKLNKKTVVRKIAEGLGYTIVF
TIGAPILLGASIVGACKWFLISKDSGKLFFKSLKEILF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattataaataaccgtacatttaataaaatgaatatatttattttatttata
aatatattggttattgatcttttctgtgtttccgtagaattttttaataaacattgtttt
tataaaacggctaatgaaaatgtaaaattggctagctcacttagtgataggttaagtagg
tcattagcactacgttctcataatgaagttggtcaacctgtgtttaatgttttaaatgta
aatttaaatacagaaattaagaaaaaggatatgatcactgaagttgaaacagaatttgaa
gtattagaagtatgtgcggaagaagaagatggtgaaaatgaaataagaataacaatgaaa
accaatttaaaaccagatatgattaaattacgtgctttaaatgaagaagtgacattaaaa
aaatgggattttattatggacgatttagctaaatgtgaatataaaaaacaaaaagaaaaa
ttaaataaaaaaacagtagttagaaaaattgcagaaggtttaggttacactattgttttt
acaataggagctcctatacttttaggtgcttcaattgtaggagcttgtaaatggttctta
atatctaaagattctggaaaattattttttaaatctttgaaagaaatccttttctaa

DBGET integrated database retrieval system