KEGG   Plasmodium falciparum 3D7: MAL8P1.32Help
Entry
MAL8P1.32         CDS       T00095                                 

Definition
(RefSeq) nucleoside transporter, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1063376..1065133)
Genome map
AA seq 585 aa AA seqDB search
MSNSNSKEHYRMDGITENKIINEDDESLLNMKKEEIILNGKFEEEPKLDLTENKIDIEEK
NNNMSEFTNIFPNITLCLMGMSSVLMYNCVLNTTPHIHALLNKNIVVSSTFFLYFSILVI
VSLLSSLFIEVKTRTYDVCFILSFILQMIYPFIIKYFYDKTVFFYVLVALIGATCSMMKT
MIFSISSIVVNDSKVICLSYGLTGIYSLFITSTFFYFVIKINKDIQKLMLSLFITSAINC
IFILVSFLCYTVLKRTNNFKEKFKIYTEERKNNKNSRDDSYKYYESITEKKSQNISYPIN
INSIIYESKTENTESKYSLTKNDSNSVGIKSSSNNTNNMTSNEIGDHKILQESHSKNKKF
NDILLNENKTLSLTHSKKEDNIDDENKNHKNQFFLFNINKKNLIKQAKIKAFLYKKSFIF
LFCSFYNIFLKILLFPVVCPEMWTNNVDERYILIGIVQFADCISRVFPSLAGTFPVFKIF
LLTQKKVLIYSLLRTILSVIGLIIPLTQDTFINNFLFKCALIFLNIYLNGWFVIMSFINV
PEILKPINSMSNVAIVSSFGSTLLRVGLLTGYGCSTLYKYIISKM
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattctaatagcaaggagcactacagaatggacggaattacagaaaataaaata
attaatgaagatgatgaaagtctcttgaacatgaaaaaagaagaaataattttaaatgga
aaatttgaagaagagccaaagcttgatttaaccgaaaacaaaattgatattgaagagaag
aataataacatgagtgagtttacaaatatttttccaaatataacattatgtttaatggga
atgtcatctgtattaatgtataattgtgtattaaatacaacacctcatatacatgcatta
ttaaataagaatatagtagtatcttcaaccttttttctatatttttctattttagttatt
gtatcattgttaagttccttatttatagaagtaaagacaagaacatatgatgtgtgtttt
atattatcattcatattacaaatgatatatccatttattataaaatatttttatgataaa
accgtttttttttatgtactagtagcattaattggtgctacgtgctctatgatgaaaacc
atgatattttccatatcttccattgttgtaaatgattcaaaagttatttgtttatcatat
ggtttgactgggatatattctttatttataacatccacatttttttattttgttattaaa
ataaataaagatatacaaaagttgatgttatcattatttataacatcagccatcaattgt
atatttatattagtgtcttttctatgttacactgtattaaagagaacaaataattttaaa
gaaaaatttaaaatttatacagaagagagaaaaaataataaaaattcacgtgatgattct
tataaatattatgaaagtataactgaaaaaaaatcacaaaatatatcatatccaataaat
attaatagtataatatatgaaagtaaaacagaaaatacggaatccaaatattcattaaca
aaaaatgattctaactcagttggtataaaaagtagtagtaataatactaataatatgact
agtaatgaaataggagatcataaaatattacaagaatctcattcaaaaaataaaaaattt
aatgacatacttcttaatgaaaataaaacattatcacttactcatagtaaaaaagaagat
aacatagatgacgaaaataaaaatcataaaaatcaattctttctatttaatataaataaa
aaaaatttaataaaacaagccaaaattaaagcattcttatataaaaaatcgttcatattt
ttattttgtagcttttataatatttttctcaaaatattattattcccggttgtttgtcca
gaaatgtggactaataatgttgatgaaagatatatattaattggaattgtgcaatttgct
gattgtataagtcgtgttttcccatcccttgcaggaacatttccagtatttaaaattttc
ctcttgacacaaaaaaaagtattaatttattctttattaagaactatcttatctgtaata
ggattgataataccattaacacaagatacatttattaataatttcctttttaaatgtgca
ctcatttttttaaatatatatttaaatggttggtttgttatcatgtcttttattaatgtt
ccagaaattctcaaacctattaattcaatgagtaatgttgcaatagttagtagttttggt
tcaacactccttcgagttggcttgttaacaggctatggatgttccacactatataaatat
atcatatcaaaaatgtga

DBGET integrated database retrieval system