KEGG   Plasmodium falciparum 3D7: MAL8P1.37Help
Entry
MAL8P1.37         CDS       T00095                                 

Definition
(RefSeq) lipoate-protein ligase, putative
  KO
K03801  
lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Lipoic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    MAL8P1.37
Enzymes [BR:pfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     MAL8P1.37
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
Position
8:complement(1040979..1042220)
Genome map
AA seq 413 aa AA seqDB search
MKVGKLKKRKNSGLLYPYFKNKSFRLNRYIFIKPIKSVKLNYKKKKMNLTHEICILNCSE
KLIDYKLAFQLQNILHHSKIIMKNKNEVQISNHLELKKFKNFKENMEKYDFCFILQHTPC
YTLGSVANCSDILLDKENYYIEELGDIYNNLYSNEIIHLMNKCETIQDKINQSDIYNENT
NYFNNFLKHCRQRKIPIYRVNRGGKATYHGPGQLVLYFIFNLKNYPSNYNERIINKHYKY
TNKENFPSKTSEYEKNNIYTNSNSKENISSIERTFDLRTTINNFQKIGMETLQKFNIKTH
CKKDTIGIFYKDKKIISIGLKITKYISMHGLSLNFNLDNNFLKYLLSCGMNHNDYISMHE
INEMKKKNYIYQKGKIASSSNILNELTLNITESLKKVFNVKVRNIKDIREMFY
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcggaaaattaaaaaagagaaaaaattctggcttgttatatccatattttaag
aataaatcatttagattaaatagatatatattcataaaaccaataaaaagtgtaaaacta
aattataagaaaaaaaaaatgaacctaacacatgaaatttgtattttaaattgtagtgaa
aaattaatagattataaactagcttttcaacttcaaaatatcctacatcattcaaaaatt
attatgaaaaataaaaatgaagtacaaatatcaaatcatttagaattaaaaaaattcaaa
aatttcaaagaaaacatggaaaaatatgatttctgttttatattacaacatactccatgc
tataccttaggtagtgtagcaaattgtagtgatatacttctagataaggaaaattattat
attgaagaattaggagatatatataataatttgtattcgaatgaaattattcatcttatg
aataaatgtgaaacaattcaagataaaattaatcaatctgatatatataatgaaaataca
aattatttcaataattttttaaaacattgtagacaaagaaaaatacccatttatcgagtt
aacaggggaggcaaagctacataccatggacctggacagttagtattatattttatattt
aacttaaaaaattatccatccaattataatgagcgaattataaataagcactataaatat
acaaacaaagaaaactttccatcaaaaacatcggaatatgaaaaaaataacatatataca
aattcaaacagtaaagaaaacatatcatctatagaacgcacttttgatttgcgcacaaca
ataaataactttcaaaaaattggaatggaaaccttgcaaaaatttaatataaaaacacac
tgtaaaaaagatacaataggtatcttttataaggataaaaaaattatatccataggattg
aaaataacaaaatatatatctatgcatggattgtcattaaattttaatctcgataacaat
tttttaaaatatctattatcatgtggtatgaatcataatgattatatatccatgcatgaa
ataaatgaaatgaaaaaaaaaaattatatttatcaaaaaggaaaaatagctagtagctca
aatatattaaatgaattaactttaaatataacagagtcattaaaaaaggtgtttaatgta
aaagtaagaaatataaaagatatacgagaaatgttttattaa

DBGET integrated database retrieval system