KEGG   Plasmodium falciparum 3D7: MAL8P1.40Help
Entry
MAL8P1.40         CDS       T00095                                 

Definition
(RefSeq) RNA binding protein, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(1023701..1024057,1024168..1024611,1024859..1024918))
Genome map
AA seq 286 aa AA seqDB search
MSLTNSSKIFIGSIPKDVTEEELKTEAAKYGTITQVYYVPATAQSPRGWAFITYEQRSEA
YKAIEALDYKCIFPNSQRPLDVRFASYKYNNSNDAQGGNKNVWQKHVTTDGHPYYYNSVT
GHSQWEKPKEMSATNFPGKGSAPSFGPPGANVFVFHLPSHWTDMELYQHFQHFGYVVSAR
IQRDANGRNKGYGFVSFNNPESALNAIKGMHGFYVSGKHLKVQLKKGEEHYVQMNTPAQP
QLTPAQPYSVQQPIIGNHHQPYMTHLMYGGMDSPNQMRYNTYSISR
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaacaaattcaagtaaaatttttattggaagtatacctaaagatgtaacggag
gaagagctaaaaactgaggcagcgaagtatggtaccataacacaagtttattacgtacca
gctacggctcagagtccaagaggatgggcatttattacatacgagcaaaggtctgaggca
tataaagcaattgaagctttagactataaatgtatttttccaaatagtcaaaggccatta
gatgtaagatttgcaagttataaatataataattcaaatgatgctcaaggaggaaataaa
aatgtatggcaaaaacatgtgacaacagatggtcatccatattattataattcagtaaca
ggacattcacaatgggaaaaaccaaaagaaatgtccgcaaccaattttcctggaaagggt
tcagcaccctcctttggtccaccaggggcaaatgtttttgtttttcatttgccatcccat
tggacagacatggagctatatcaacattttcaacactttggctatgttgtaagcgcacga
attcaacgagatgccaatggaagaaataaaggatatggttttgttagttttaataatcct
gagtcagctttaaatgcaataaaaggtatgcatgggttttacgtatcaggaaagcattta
aaggttcagctaaaaaaaggggaagagcattatgtacaaatgaatacaccagcacaacca
caattaacacctgcacaaccatactcagttcaacagcccatcataggaaatcaccaccaa
ccttatatgacacatttaatgtatggaggtatggactccccaaatcaaatgagatacaac
acatattctataagtagatag

DBGET integrated database retrieval system