KEGG   Plasmodium falciparum 3D7: MAL8P1.43Help
Entry
MAL8P1.43         CDS       T00095                                 

Definition
(RefSeq) U5 snrnp-specific protein, putative
  KO
K12857  
Prp8 binding protein
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    MAL8P1.43
Spliceosome [BR:pfa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U5 snRNP specific factors
    MAL8P1.43
 Complex C
   U5 SnRNP specific factors
    MAL8P1.43
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1006908..1007882
Genome map
AA seq 324 aa AA seqDB search
MALIKADTYVLERDENNEVEERKTGLFSPTMLINSHKGEVYSINFSSDGKYIASSSFDMT
IMVHNVYNECETIGVLRGHKNAVLQAKWLQDDNYICSASADHKLFLWDVECESKLRSFKG
HDNIVNGLDIINHNLFVSCSDDNTLKFWDIRSKWAVHIIKHDFPLLSVCSDKKGEFLFTS
CVDNTIKKYDCKNYKLKDTFIGHKDYITGLDINKDETMLASISADESICFWDIQPFSCEE
KLLFQLNSPKYNIDYNLIKLSFNNDNLLACGSGDNYLYIYDYKQKILKYSLPGHTSTIND
VAFHPVEDIVASCSSDHTIFLGEI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctttaataaaagctgatacgtacgttttagaaagggatgaaaacaatgaagtggag
gaaaggaaaacaggattattttccccgacaatgttaataaatagtcataaaggagaagtg
tattcaattaatttttcttcggatggaaaatatatagcatcatcaagttttgatatgact
ataatggttcataatgtttataatgaatgtgaaactataggtgttttaagaggtcataag
aacgcagtattacaagctaaatggttacaggatgataattatatatgtagtgcatcagct
gatcataaattatttttatgggatgttgaatgtgaatccaagttaagaagttttaaagga
catgataatattgttaatggattagatataattaatcataatttatttgtttcttgtagt
gatgataacactctaaaattttgggatataagaagtaaatgggctgttcatataataaaa
catgattttcctttattaagtgtttgttcagataaaaaaggagaatttctttttacaagt
tgtgttgataatacgataaaaaaatatgattgtaaaaattataaattaaaagatactttt
ataggtcataaagattatataacaggattagatattaataaggacgaaacaatgcttgct
tcgataagtgcagatgaatctatttgcttctgggatattcaacctttttcatgtgaagaa
aaattattatttcaattaaattcaccaaaatataatattgattataatttgattaaatta
tcttttaataacgataatcttttagcttgtggaagtggagataactatttatacatatat
gattataaacaaaaaatattaaaatattccttaccaggtcatactagtactattaatgat
gttgccttccaccccgttgaagatattgtggcatcatgttcttcagatcacaccatattt
ttaggggaaatatga

DBGET integrated database retrieval system