KEGG   Plasmodium falciparum 3D7: MAL8P1.48Help
Entry
MAL8P1.48         CDS       T00095                                 

Definition
(RefSeq) small nuclear ribonucleoprotein, putative
  KO
K11099  
small nuclear ribonucleoprotein G
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Spliceosome
Module
Spliceosome, U1-snRNP
Spliceosome, U2-snRNP
Spliceosome, U4/U6.U5 tri-snRNP
Sm core complex
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    MAL8P1.48
Spliceosome [BR:pfa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    MAL8P1.48
  U2 snRNP components
    MAL8P1.48
 Complex B
  U1 snRNP components
    MAL8P1.48
  U4/U6.U5 tri-snRNP components
    MAL8P1.48
 Complex C
  U2 snRNP components
    MAL8P1.48
DNA replication proteins [BR:pfa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     MAL8P1.48
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(989354..989535,989767..989836))
Genome map
AA seq 83 aa AA seqDB search
MTLTVGKAGPASDFRKFMEKRLQIYLNGNRQVVGILRGYDTFMNLVLDNTMEIKKDEQID
IGVVVIRGNSISYWECLDKVNIK
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgactttaactgttggaaaggcaggaccagcatctgattttcgaaaatttatggaaaag
agattgcaaatttacttaaatggtaatagacaagttgtcggaatattaagaggctatgac
acatttatgaatttagttttagataatacaatggagataaaaaaagatgaacaaattgat
ataggtgtggttgtaataagaggaaatagtatatcttattgggaatgtttagacaaagtt
aatataaaatga

DBGET integrated database retrieval system