KEGG   Plasmodium falciparum 3D7: MAL8P1.51Help
Entry
MAL8P1.51         CDS       T00095                                 

Definition
(RefSeq) Sec61 beta subunit, putative
  KO
K09481  
protein transport protein SEC61 subunit beta
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Protein export
Protein processing in endoplasmic reticulum
Phagosome
Module
Sec61 complex
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    MAL8P1.51
   04141 Protein processing in endoplasmic reticulum
    MAL8P1.51
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    MAL8P1.51
Secretion system [BR:pfa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   MAL8P1.51
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(977148..977194,977432..977548,977640..977718)
Genome map
AA seq 80 aa AA seqDB search
MNAAPVIVGGMRTPARRRQSNASANGNNSKQRRNSNGNSNSIVKFYGDDSPGFKLTPQTV
LISTLIFMASVVILHIISKI
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgcaccagtaatagttggtggtatgagaacaccagcaagacgaagacaaagt
aacgcctctgctaatggtaacaattcaaaacaaagaagaaatagtaatggaaactctaac
agcatagtgaaattttatggtgatgattctcctggatttaaattaactccacaaactgtc
ctcatctctacattaatatttatggcaagtgtagttattttacatatcattagtaaaata
taa

DBGET integrated database retrieval system