KEGG   Plasmodium falciparum 3D7: MAL8P1.6Help
Entry
MAL8P1.6          CDS       T00095                                 

Gene name
ETRAMP8, etramp.BLOB.2
Definition
(RefSeq) early transcribed membrane protein 8, ETRAMP 8
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1270206..1270718
Genome map
AA seq 170 aa AA seqDB search
MKVFIFFAFVNFLFVLNLFSPCTCKKDYGKEWVKDKLSLVNLKLEKYDKKKKFALISGAA
IGALALITLIGGIYMTKGRKSSIWHNSEINDTLYDVVLETVNQGNTDVKLAFQRGVKLDD
AVPSEATFKKYLKQNIKDRNLNLTWQEERELYRMLPYIRFNVERLAVFLR
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttatttttttcgcttttgttaattttttgtttgttttgaatttattttcc
ccttgtacgtgtaaaaaggattatgggaaggaatgggttaaggataaattaagtttagta
aatttaaaattagagaaatatgataaaaaaaagaaatttgctcttatatcaggagcagct
ataggagccttagcattaataacacttataggaggtatttatatgactaaaggaagaaaa
agttccatatggcataattcagaaataaatgatacactttatgatgttgttcttgaaaca
gtgaatcaaggaaatacagatgtaaagttggcttttcaaagaggagtaaaactagatgat
gctgttcctagtgaggcaacatttaaaaaatatttaaaacaaaatattaaagatcgaaat
ttaaatttaacatggcaagaagaacgggaattatatagaatgcttccttatattcgcttt
aatgtcgaaagactagctgtatttcttagatga

DBGET integrated database retrieval system