KEGG   Plasmodium falciparum 3D7: PF08_0002Help
Entry
PF08_0002         CDS       T00095                                 

Definition
(RefSeq) 3D7Surf8.2
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(1311708..1313414,1313584..1318026)
Genome map
AA seq 2049 aa AA seqDB search
MLMVIEFDDPIKEPSDKRISINRFREVFVNYVEDTLEELANNTTNTYEKKCRDFNYFIDD
VKDMFINHDLVKSTPEILKKVWESDIDKNLPGLMEKTTKNTCVRVAHDYEKEYRDLRKNL
EDFCDEKIERLAKLKISNNYMNDCFDYNKWINEKRNEFITGMTGMDRRKKQMYLRKSDSC
DLNNLANLFLNIICTRPRDVPGKPSSKDSGVKDKKKDDGSEEEVVKDDNGDTSKGTSSDG
DKDKSVEDTYDVDISEDGSPNEDISIVIEEPAQCEEGDHCFDIIKFYESHKNGVPPIDIN
LSVRCPLNYHGIFRKGNKLYKSIENKSESNSMKRSSKRSIGSENEQAISDNTDMEIIIDG
DPYSAPCFIPEEEPCRPSVQETEGGKTGKGIFPHSESSNNNVVPKTEVTLNFISPDRDRI
NPPERTYNLMNDGFMSTKNLLSVSGGNDIMYISHRSHAAPTNARLGRSTMTPKAEKSTLD
DIKELIFSFPTNEAQKYESSSVTVPTSSTINQVNNDNVSTHTGSNENGTVQKKDEIPETN
RKENKIYSYFFNSILAIFIIFIIYQIFMKESTFLWFSKNDKKRRIMKNIQEKVTKKMRKS
DISEKFEKDIVDMKPTKSDIIRDRFIRNIYNVQYRNEFDEEIKDYIQLKYLIYDDEERTK
KKKYHEEYEKKDFQDDVIKTEKDKIFLSKEREWKWKTIIEIHMEVLEDCKNEEWEKNKGD
FLEICIEEFMKEDNEFNNNIKKNKDDLLINKNEDIYFSNVIEKQIGLWNKWIERHRYMIE
KWKKEDWFCDLKETLKNEFEEQMDIGKVSFLYENNREYGKNFYLEKQKIIWKRWIARYVK
HIDDYIIEIWFKRMMDELEKAQGNLGKSSCEKDEIINIESNHENLNFYKKKKKKLINKIW
IQIHMMLLEEYKKEECKRSKNILLDNYIDILKRDGNEKKNMNILEILIEMKKKYISENED
YEKKVFKEDKVFEDYMGDWEYYEKNYINEKENDTYKQDDIKIKKYFLENPFVEMEKDMTE
RYMNNIYDNYLSKGYEQETIIKSIHEINDTKKSIEEFHKEEKYDDTEKKKEKWKTVIEIY
MEVFNESKKDEWEECRGDFLQICLEEFLKTKDGINRDDNINEGDNINRDDNINEGDNINK
GDNINKGDNINKGDNINKGDNINKDGYINETDYLYSEENIKGYDHINTYPINGDIKNKYL
LERQKIIWLKCIKRNKYILEKWKNEEWFKKLKYNWNDEVNRKLHGNNLYDNVNTNNKRNP
MIERQKIIWRKWIAKHVYNIDIMENEEWFKEFIKKYEKEDYDYISGTYEIQEEIKKKKLL
SKVFIDIYMMVLEDFKEEECKKNKEIFLDTYIDELKKDSQSEKNKSMLNILDEIKSDIHI
GYQKENMKEWKNKHWFEKLKKEWNIRENKNYDEIEKNKMEKIHFTVINNYMLEIQNAIMK
KYWDDMEIQWIDYDNKTDWLKIAVQLSNNEKNVCNSRYDYIRNNNLYNKNKYMTIEEQDM
KEVDTYDTYEKNLLFFERIIKMYMELLGEYKKADWDKNKGDFLKIALEEFVETKYEKQND
LRIIERINDNNNNEYDENYISIQQNLLWNKWIERKRYIIEKWKNEEWFEKLKSEWKKEQN
KDIKQDQIQILIEKKENSVTDNYDNINILTEIEKILWRNWLRNQKSVMGKYKDQKWFKDV
LYKYEKELKELENLKSDYLKNDISKIMDEELDMKNREYLIIQMWMEIHMMILEDCKKDEY
INSEEIFLDACVEKLKNEKNEKYQNRMLEIIMNIKEKHMLSKKEYMKNEWKKKEKLFEIF
KKNCISEQDKYILEEEIQKDIIKDIEKNKRYINNNDDIIKNGYIEKQKAICKKRVEKYLR
HMDELSEENSFINFMTKDQIRNSNNNELEKLIKEEILKKILSTEMDMTFLDEFNKGEFME
NSEDSINVDIKRKRKKKEKHIMENDDENIYKMENDDENIYKMEKEDNFININELELHKEF
DNNNKVKLKELHTEFHKDEQEILSSQYENIENAMINDNENYDNSNYMKNIIEQKMIILKE
YYNRKKYTL
NT seq 6150 nt NT seq  +upstreamnt  +downstreamnt
atgttgatggtcattgaatttgatgatcctattaaagaaccttcagataaacgaatttct
attaataggttcagagaagtttttgttaattatgttgaagatacacttgaagaattagct
aacaatactacgaacacgtatgaaaaaaaatgtcgtgactttaattattttattgatgat
gtaaaggatatgtttattaatcatgatttggtaaaatctactcctgaaatacttaaaaaa
gtatgggaaagtgatatagataaaaatttaccaggcttgatggagaaaacaaccaaaaat
acttgtgttagagttgcacatgattatgaaaaggaatatagagatttgagaaagaactta
gaagatttttgtgacgagaaaattgagagattagcaaaattaaagataagcaataattat
atgaatgattgttttgattataataaatggataaacgagaaaagaaatgaatttattacc
ggtatgactggtatggatagaagaaaaaaacaaatgtatttacgaaaatcggattcatgt
gatcttaataatttagcaaatttatttttaaatataatctgtaccaggcctagggatgtt
cctggtaaacctagtagtaaagatagtggagtaaaggataaaaaaaaagatgacggatct
gaggaagaagtagttaaagatgataatggtgatacttctaagggaacctcgagcgatgga
gataaagataaatctgtggaggatacatatgatgtagatattagtgaggatggatcaccc
aatgaggacatatctattgtaatagaagaacctgcacagtgtgaagaaggtgatcattgt
tttgatattataaaattttacgaatcacataaaaatggtgttccccctatagatattaat
ctatctgttagatgccctttaaattatcatggaatatttcgaaaaggaaataaactgtac
aaatcaatagaaaataaaagcgaaagcaattcaatgaaacgtagttcaaaacgatcgatt
ggtagcgaaaatgaacaagctatttctgataatacggatatggaaataattattgatggt
gatccttactctgctccttgttttattcctgaggaagaaccatgtagaccttctgtacaa
gagactgaaggtggaaaaacaggaaagggaatttttcctcattctgaaagtagtaataat
aatgtagttccaaaaactgaagttacattaaatttcatatcacctgatagggatagaata
aatccgcctgaacgtacttataatttgatgaacgatggctttatgagtactaaaaatctt
ttatcagtgagtggaggtaatgatattatgtacatttctcatagaagccatgcagctcct
actaatgctaggttaggaagaagtacgatgacacctaaagctgaaaaatctacattagat
gatattaaagaattaattttttcttttcctactaatgaagctcaaaagtatgaatcatca
agtgttactgttcctactagttcaacaattaatcaagtaaataatgataacgtcagtaca
catacaggaagtaacgagaatggaactgtacagaagaaagatgaaattccagaaacaaat
agaaaggagaataaaatatattcttattttttcaatagcattttagcaatttttataata
tttattatttatcaaatttttatgaaagaaagtacctttttatggttttctaaaaatgat
aaaaagagaagaataatgaaaaatatacaggaaaaggtaactaaaaaaatgagaaaaagt
gatatatcagaaaaatttgagaaggatattgtggatatgaaacccacaaaaagtgatata
atacgtgataggtttataagaaatatatataatgttcagtatagaaatgaatttgatgaa
gaaataaaagactatattcaattaaaatatttaatatatgacgatgaagaaagaacaaaa
aaaaaaaaatatcatgaagaatatgaaaagaaggatttccaagatgatgtaataaaaaca
gaaaaggataaaatatttttgtcaaaagaaagagaatggaaatggaaaaccattattgag
atacatatggaagtattagaagattgtaaaaatgaagaatgggaaaaaaataaaggagat
tttttagaaatatgtatagaagaatttatgaaagaagataatgaattcaataataatata
aaaaaaaataaagatgatttgttgataaataagaatgaggatatatatttttcaaatgta
atagaaaaacaaataggtttatggaataaatggattgagagacatagatatatgatagaa
aaatggaaaaaagaagattggttttgtgatttaaaagaaacgttgaaaaatgaatttgaa
gaacagatggatataggaaaagtatcttttttatatgaaaataatagagagtatggaaaa
aatttttatttggaaaagcaaaaaattatatggaaaagatggattgcaagatatgtgaaa
catattgatgattatataatagaaatatggtttaaaagaatgatggatgaattagaaaag
gcacaaggaaatttaggaaaatcttcttgtgaaaaggatgaaattataaatatagaaagt
aatcatgagaatttaaatttttataaaaaaaaaaaaaaaaaattaattaacaaaatatgg
atacaaatacatatgatgttattagaggaatataaaaaggaagaatgcaaacgaagtaaa
aatatcttattggataattatatagatattttaaaaagagatggaaatgaaaagaaaaat
atgaatattttagaaatattaattgaaatgaaaaagaaatatatatctgaaaatgaagat
tatgaaaaaaaagtatttaaagaagataaagtgtttgaagattatatgggagactgggaa
tattatgaaaagaattatataaatgaaaaagaaaatgatacttataaacaagatgatata
aaaattaaaaaatattttttagaaaatccttttgtggaaatggaaaaagatatgacagaa
cgttatatgaataatatatatgataattatttaagtaaaggctatgaacaggagacaatt
ataaaatccatacatgagataaatgacacaaaaaaatcaattgaggaatttcataaggaa
gaaaaatatgatgacacggaaaagaaaaaggagaaatggaaaactgtaattgagatatat
atggaagtgtttaatgaatctaaaaaggatgaatgggaagaatgtaggggagatttttta
caaatttgtttggaagaatttttaaaaacaaaggatggtattaatagggatgataatatt
aatgagggtgataatattaatagggatgataatattaatgagggtgataatattaataag
ggtgacaatattaataagggtgacaatattaacaagggtgataatattaacaagggtgat
aatattaataaggatggttatataaatgaaacagattatttatatagtgaggaaaatata
aaaggatatgatcatataaatacatatccaataaatggagatattaaaaataaatattta
ttagaaaggcaaaaaattatatggctaaaatgcattaagagaaacaaatatatattggaa
aaatggaaaaatgaagaatggtttaaaaagctgaaatacaattggaatgatgaagtaaac
aggaaattacatggaaataatttatatgataatgtaaatacaaataataaaagaaatcct
atgatagaaaggcaaaaaattatttggagaaaatggattgcaaagcatgtatataatatt
gacataatggaaaatgaagaatggtttaaagaatttataaaaaaatacgaaaaagaagat
tatgattatataagtggaacatatgaaattcaagaggaaataaaaaagaaaaaattattg
tcaaaagttttcatagatatatatatgatggtattagaagattttaaagaagaagaatgt
aaaaagaataaagaaatatttcttgatacttatatagatgaactaaaaaaagattcgcaa
agtgaaaaaaataaaagcatgttaaatatattagatgaaataaaaagtgatattcatata
ggatatcaaaaagaaaatatgaaggaatggaaaaataaacattggtttgaaaaattgaaa
aaagaatggaatataagggaaaataagaactatgatgaaatagaaaaaaataaaatggaa
aagatacattttactgtaattaataattatatgttagaaatacaaaatgctataatgaaa
aaatattgggatgatatggaaatacaatggatagattatgataataaaacggattggcta
aaaatagctgttcaattaagtaataacgaaaaaaatgtatgtaacagcagatatgattat
attagaaataataatttatataataaaaataaatatatgactatagaggaacaagatatg
aaagaagttgatacatatgacacatatgaaaaaaatcttttattttttgaaaggattatc
aaaatgtatatggaactgttgggtgaatataaaaaagctgactgggataaaaacaaagga
gattttttaaaaattgctctagaagaatttgtagaaacaaaatatgaaaaacaaaatgat
ttaagaattattgaaagaataaatgacaataataataatgaatatgatgaaaattatata
agtatacaacagaatttattatggaataaatggatagaaagaaaaagatatataattgaa
aaatggaaaaatgaagaatggtttgagaaattaaagagcgaatggaaaaaagaacaaaat
aaagatataaagcaagatcaaatacaaattttgattgaaaaaaaagaaaacagtgttact
gacaattatgataatattaatatattaacagaaatagaaaaaatattatggagaaattgg
ttaagaaatcaaaaaagtgtaatgggaaaatataaggatcagaaatggtttaaagatgta
ttatataaatatgagaaagaactaaaagaattagaaaatttaaaaagcgattatctgaaa
aatgatatatcgaaaataatggatgaagaattagatatgaagaatagagaatatttgata
attcaaatgtggatggaaatccacatgatgatattagaagattgtaaaaaggatgagtat
ataaatagtgaggaaatatttttggatgcttgtgtagaaaaattaaagaatgagaaaaat
gaaaaatatcaaaataggatgcttgaaattataatgaatataaaggaaaaacatatgtta
tcaaaaaaagaatatatgaaaaatgaatggaaaaaaaaagagaaattgtttgaaattttt
aaaaaaaattgtatcagtgaacaagataaatatatattagaagaagaaattcagaaggat
ataattaaagatatagaaaaaaataaaagatatattaataataatgatgatataataaaa
aatggttatatcgaaaaacaaaaagctatttgtaaaaaacgcgttgaaaaatatttaagg
catatggatgaattaagtgaagaaaattcgtttataaattttatgacaaaggatcaaata
agaaattcaaataataatgaattagagaaacttattaaggaagaaatattaaaaaagata
ttaagtacagagatggatatgacattcttggatgaatttaataaaggtgaatttatggaa
aatagtgaggattctataaatgttgatataaaaagaaaaagaaaaaaaaaagaaaaacat
ataatggaaaatgatgatgaaaatatatataaaatggaaaatgatgatgaaaatatatat
aaaatggaaaaggaggataattttataaatataaatgaactggaattacataaagagttt
gacaataataataaagtaaaattaaaagaactacatacagaatttcacaaggatgaacaa
gagatattatcaagccaatatgaaaatatagaaaatgcaatgataaatgataatgagaat
tatgataatagtaattatatgaagaatataattgaacaaaaaatgattattctaaaagaa
tattataacaggaagaaatatacactgtaa

DBGET integrated database retrieval system