KEGG   Plasmodium falciparum 3D7: PF08_0003Help
Entry
PF08_0003         CDS       T00095                                 

Definition
(RefSeq) tryptophan/threonine-rich antigen
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(1297205..1299055,1299223..1299399))
Genome map
AA seq 675 aa AA seqDB search
MNLEQFKNINKDLATNLFSQLSFLKNENKFLSQGKSLIKFLIGIAIFLVVLIFIKSSHPA
LKEKKKKVLEFFENLVLNKKKKENITAAIASKELADAETTDTSDSEDEDHIINKKVKRRK
RNIINNPDEKVHNVKEKNSKSKNEEDKTDESYNETSLLSSDEEGEVNLEDWKKNEWIKWM
DETEEEWQLLKLWLEGEKNKWLEGKNKEYDIWLNHMNSKWTNYNKDIDEEYDSNVFKDSY
KWNEKQWEQWMKTEGKEFMLQDFKRWLEDSEGYLKSWLIKQWIQWKNMKILECLMNEWRR
EEDEKWSNLEDTDQIRVLNHKDRKEWLRWKERVTREKLEWKHWVEMKENMNIYNKWKKWI
KWKKNKLANFNEWSKNFIEKWIREKQWNNWINERKKYTSQRKSLEQQFGDNMDKMNKLKK
KKILKFFPLFNYKSDLESIMEEDENEYNSFDENEEENDEKTGDVNVGKTEALNVAKTEGL
NVGKTEDLNVAKTEDLNVAKTADLNAEKTTDLNSEKTADLNSDKTTDLNPEKTTNFNTYK
ATDLNANKTADLNSDKTTDLNSDKTTNFNTYRTTDLNSDKTTNFNTYKTDLYAEKTTDVN
LGKTTNHNVAKTTDQKVVKHSLDHEVRQMIDQKVAQIMNHDLESTAEQKAEKKGGKAKAK
TKVRTVDDDGNEINV
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagagcagtttaaaaatataaacaaagatctggctacaaatcttttttctcaa
ctatcatttttaaaaaatgagaataagtttttgagccagggtaaatctcttattaaattt
cttatcggaatagccatatttctagtcgttctcatatttataaaatcgtctcatccagct
ctcaaagagaagaagaaaaaggtgctagaattttttgaaaaccttgtattgaataagaaa
aaaaaagagaatataacagcagcgatcgcatccaaagaattggctgatgctgaaacaaca
gatacaagcgattcagaagatgaagatcatattattaataaaaaagtgaaaagaagaaaa
aggaatatcataaataatcctgatgagaaagtacataacgtaaaagaaaaaaatagtaaa
agtaaaaatgaagaagataaaacagatgaaagttacaatgaaactagcttattatcttct
gatgaagaaggtgaggtgaatttagaggattggaaaaaaaacgaatggattaaatggatg
gatgaaacagaagaagaatggcaacttttaaaattatggttggaaggagaaaaaaataaa
tggcttgaagggaaaaataaggaatatgatatatggttaaaccatatgaatagtaaatgg
acaaattataataaagatatagatgaagaatatgattcaaatgtttttaaagattcttac
aaatggaatgaaaaacaatgggaacaatggatgaaaaccgaaggaaaagaattcatgtta
caagattttaaaagatggttagaagacagtgaaggatatttaaaatcatggcttatcaaa
caatggatacaatggaaaaatatgaaaattctggaatgtctaatgaatgaatggagaaga
gaagaagatgaaaaatggtcaaacctagaagatacagatcaaatcagagtattaaatcac
aaagatagaaaagaatggcttagatggaaagaaagagttactagagaaaaactcgaatgg
aaacattgggtagaaatgaaagaaaatatgaatatatataataagtggaaaaaatggata
aaatggaagaaaaataaattagctaattttaatgaatggtcaaaaaattttatagaaaaa
tggatacgagaaaaacaatggaacaattggattaatgaaagaaaaaaatatacatctcaa
agaaaaagtttagaacaacaatttggagataatatggataaaatgaacaaattaaaaaaa
aaaaaaattttgaaattcttcccactatttaattataaaagtgatttggaatcaataatg
gaagaagatgaaaacgaatacaacagttttgatgaaaacgaagaagaaaacgatgaaaaa
acaggagatgttaatgtaggaaagacggaagctttgaatgtagcaaagaccgaaggtttg
aatgtaggaaagacggaagatttgaatgtagcaaagacagaagatttgaatgtagcaaag
acggcagatttgaatgcagaaaaaacaacagatttgaattcagaaaaaacagcagatttg
aattcagacaaaacaacagatttgaatccagaaaaaacaacaaattttaatacatacaaa
gcaacagatttgaatgcaaacaaaacagcagatttaaattcagacaaaacaacagatttg
aattcagacaaaacaacaaattttaatacatacagaacaacagatttgaattcagacaaa
acaacaaattttaatacatacaaaacagatttgtatgcagaaaaaacgacagatgttaat
ctaggaaaaacaacaaaccataatgtagcaaaaacaacagatcaaaaggtagtaaaacat
tcgttagatcacgaagtaagacaaatgatagaccaaaaagtagcacaaataatgaaccat
gacttagaatcaacagcagaacaaaaagcagaaaaaaaaggaggaaaagcaaaagcgaag
acaaaagtaagaacagttgatgatgacggaaatgaaattaatgtttaa

DBGET integrated database retrieval system