KEGG   Plasmodium falciparum 3D7: PF08_0009Help
Entry
PF08_0009         CDS       T00095                                 

Definition
(RefSeq) translation initiation factor EIF-2b alpha subunit, putative
  KO
K03239  
translation initiation factor eIF-2B subunit alpha
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    PF08_0009
Translation factors [BR:pfa03012]
 Eukaryotic Type
  Initiation factors
   eIF-2B
    PF08_0009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(1227822..1228508,1228810..1229023,1229161..1229236,1229430..1229481))
Genome map
AA seq 342 aa AA seqDB search
MECYDNTKQKDLQEEHDVVRNFRRYYFQEKEEMHIAAIKSISDVLKNSISETNFELFINM
NEAKCKLNNFINNNQTQQDIISVPHSKRMTIYPIISSCDIYHHFVVKKYTHNENNFHVLK
NVIENNADEFSASLQKSLETIGSSSNIMFLNKHTTILTHSNSDCVKSLIMDVVKNQNKQV
SIYFTCTSQVNLNYEEKEKKFDENFLEELNKENINITKIDLTQVKDIINKIDFVLIGSEI
VTDNGGIINKKGIKLISELCLLYKKPFYVTCQAYKFLKIDKNKCSKDFYTFCTQTVTNNF
NNIYEFVSPDFITLFYTDIGIFPPSNISYELSKLYINDAFYF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggaatgttacgataacacgaaacagaaggatttacaagaagagcacgatgtggtacgt
aatttcagaagatattattttcaggaaaaagaagaaatgcatatagcagccataaaatca
atatccgatgtcttaaaaaatagcatatcggaaacgaactttgaattatttattaatatg
aatgaagcaaaatgtaaattaaataattttattaataataatcaaacacaacaagatatt
atatctgtcccacattccaaaagaatgactatatatccaataatttcctcgtgtgatata
tatcatcattttgttgtaaaaaaatacacacacaacgaaaataacttccatgtacttaaa
aatgttatcgaaaataacgcggatgaattctcagcaagcctacaaaaaagtcttgaaact
atcggaagtagtagcaatattatgttccttaataaacatactactatactaacacacagt
aactcagattgtgttaaatctctaatcatggatgttgttaaaaatcaaaataaacaagtg
tccatttattttacctgcacaagtcaggtaaatttaaattatgaagaaaaagaaaagaaa
tttgatgagaattttttagaagaattaaataaggaaaatataaatataacaaagatagat
ttaacacaagtaaaagatataataaataaaatagatttcgttttgataggatcagaaata
gttacagataatggaggaataataaataaaaagggtatcaaattaatatctgaattatgt
ttattatataaaaaaccattttatgtaacatgtcaagcatataagtttttaaaaattgat
aaaaataaatgttcaaaagatttttacacattttgtacacaaacagtaacaaataatttt
aataatatatatgaatttgtatctccagattttattacacttttctataccgatataggt
atattcccaccttctaatatatcttatgaacttagtaaattgtatataaatgacgccttt
tatttctaa

DBGET integrated database retrieval system