KEGG   Plasmodium falciparum 3D7: PF08_0011Help
Entry
PF08_0011         CDS       T00095                                 

Definition
(RefSeq) leucine-tRNA ligase
  KO
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, eukaryotes
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    PF08_0011
Enzymes [BR:pfa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     PF08_0011
Amino acid related enzymes [BR:pfa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   PF08_0011
Transfer RNA biogenesis [BR:pfa03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    PF08_0011
 Prokaryotic Type
    PF08_0011
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PF08_0011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1217343..1221788
Genome map
AA seq 1481 aa AA seqDB search
MFFKFVRFLIYIFLYSLCYQHVNNVFALHINKYKNVFLFESPSVLIKNRRNYKRKIYSHD
EEKGKYDFHRIEEKWQTIWNSKRLLDKDFEQYNKINLGRKEKKEKRHKDKQNGFIDKPYN
DVYEKGDNTYKYNKKKFYILDMFPYPSSEGLHVGHILCFTITDIISKFKKMNNYCVFHPI
GWDSFGLPCDRLSMKKKIDPREIIHKNISNFKNQLIKLGFLFNWESEINTCDENYYKWTQ
WIIIQLFLNNLSYKKRSYVNWSNELRCVISNDELRNEINLQYLNIQKIKLLQWYLKITKY
ANRLIKDLNMIHWPMKIKNMQINWIGKKTGIFLKARIISLDKFLNNTHFNFVNIKKSYNN
NMINVFYNNIFNHLFFIFINYILSIFTFHMYINNPNEQKQQQKKNTHIKELNNKIQKYNY
INKYDFFFSYHQNDLFLFFSFFFNYYHNRNIDQMKKQKLNLPTEPFKNEQIRVSHNKENN
NNSSNLETNWVSFNIQNCNDMIINILFNNMETYNENYFLYPLKDATKGKNYINGHNSNDN
MFNDNMFNDNMFDDNMFDDNMLKDQNSYVQIFLNKNEVILQNDKLIISVNHPNIRNIVNH
NPFLLKFIDKMVLENDTVRLKNEELYFTGSVIYFPIMNKMIPVFLCAYILDNNKNFLFLK
KEMTQTQDKNSNTNISLLYKMLQDSNYSKKKNIYNLKDWLFSRQRYWGEPFPFLYKMKDK
NGYMDNTKIKNDDHMNENNHNNNMLSDCKDINNFSNYNDQNNNKKIRIRKVINSPNNNIY
IDDIPLKLPNFNKKIYEIDPHNEQDVNNISSVLSRFKKWMITKKYNMLYKRESDIMPQWA
GSSWYFLRYIDSKNKKRIFNKKKINSWLPVDLYVGGSEHAVLHLLYSRFFHKFLYDLKLT
KHKEPFQKLFNQGLLLNTTSFYLYTTLDNKPVSFDQINEKKINTNAYDYTNRGTNHHIQL
NKKENEKKKKTYSQNVCETTNLLTSQVLPDHASFCSGDQNGNINKELKNERNENMKEKDI
DILRKSKINDDMKEKAIDMLGKNRINDDMKEKAIDMLGKNKINDDMKENVIDMLGKNNYT
IVDNKYKKFLIEEDYVKEGKDQKYYLKSFPSIEVQPNYEKMSKSKGNTINPLDIVKTYGS
DCLRLHILFLGPVDQNKKWTTKGIKGTFKFLNNLYNLFIQRCDIKNNKESNKKNVCTRVV
DNSMNDMMFHKDNIEKSANHILSNNGYEKKKKINLENGEKKIEYMICKNCKRKSSNKKLI
LNFLKNKYGFIIANEKYKKVNDYVNIILKNDSHVFNKLSDKIKKIKIEDIENEKKKKVNY
YIEKITNCINDIKLNTAVSFFMKFYNEIKTWDIVPLKIFIIFVKLLYPFCPHICEEFWFY
YLKRYKIKKRKKLCYFCNSNLLYYGKWPSLFEIKQNKLVNISIKLNNKHITFLQRDVSST
SDITEEATNLIKHKIENEMKKGKKIVNIVNIPNKVINFIIK
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaagtttgtccgctttttaatatacatatttctgtactccttatgctatcaa
catgttaacaatgtttttgcgttacatattaataaatataagaatgtgtttttatttgaa
tcacctagtgtgttaataaagaacagaagaaactataagaggaaaatatattcacatgac
gaagaaaaaggaaagtacgattttcataggattgaggaaaaatggcaaaccatatggaat
tcaaagcgtttgttagataaggactttgagcagtataacaaaattaatttgggaagaaaa
gaaaaaaaggaaaagagacataaggataaacaaaatggtttcattgacaaaccatataac
gatgtatacgaaaaaggtgataatacatataaatataataagaaaaagttttacatatta
gatatgtttccttatccttcctcagaaggattacatgtaggtcatatattatgttttacg
ataaccgatattattagtaaatttaaaaaaatgaataattattgtgtttttcatccgatt
ggttgggattcctttggattaccatgtgatagattatcgatgaaaaaaaaaattgatcct
agagaaattatacataaaaatatatctaattttaaaaatcaattaataaaattaggtttt
ctttttaattgggaaagtgaaataaatacatgtgatgaaaattattataaatggacacag
tggataattatacaattgtttttaaataatttaagttataaaaaacgttcctatgttaat
tggtcaaatgaattacgttgtgttatatcaaatgatgaattaagaaatgaaatcaattta
caatatctgaatatacaaaaaattaaattattacaatggtatcttaaaattaccaaatat
gcaaatcgtctaatcaaagatctaaatatgattcattggcctatgaaaattaaaaacatg
caaattaattggattgggaaaaaaacaggtatatttctaaaagctcgaattatttcctta
gacaagtttttaaataatactcatttcaattttgttaacatcaagaagtcttataataac
aatatgataaatgtattttataataatatttttaatcaccttttttttatatttataaat
tatattttatctatatttacttttcacatgtatatcaataatccaaatgaacaaaaacaa
caacaaaaaaaaaatacacatataaaagaattaaataataaaatacaaaaatataattat
attaacaaatacgattttttcttttcctatcatcaaaacgatctttttcttttcttttcc
tttttttttaattattatcataatagaaatattgaccaaatgaaaaaacaaaaattgaat
cttccaacggaaccttttaaaaatgaacaaattcgtgttagtcataataaagaaaataat
aacaattcatcaaatcttgagacaaattgggtaagttttaatatacaaaattgtaatgat
atgataataaatattttgttcaataatatggaaacctataatgaaaactatttcttgtac
ccccttaaagatgctacaaaaggtaaaaattatataaatggtcataatagtaatgacaat
atgtttaatgacaatatgtttaatgacaatatgtttgatgacaatatgtttgatgacaat
atgttgaaggaccaaaattcatatgtacaaatttttttaaataaaaatgaagttattctt
cagaatgataaattaataataagcgttaatcatccaaatattagaaatattgttaatcac
aatccttttttattaaaatttattgataaaatggttcttgaaaacgatactgtaagatta
aaaaatgaagaattatatttcacaggttcagttatttattttcccataatgaataaaatg
attcctgtttttttatgtgcatatattttggataataataaaaatttcctctttttgaaa
aaggagatgacacaaacacaggacaaaaatagcaatactaatatatcattattgtataaa
atgttgcaagattcaaattatagtaaaaaaaaaaatatttataatttaaaagattggtta
ttttcaagacaaagatattggggagaaccatttccttttctttataaaatgaaagataaa
aatggatatatggataacactaaaattaagaatgatgatcatatgaatgaaaataatcat
aataataatatgttgagtgattgtaaagatattaataatttttcaaattataatgatcaa
aataataataaaaaaataagaataagaaaagtgataaactcgccaaacaataacatatat
atagatgatattcctttaaagttaccaaactttaataaaaaaatatatgaaatagatcct
cataacgaacaggatgtaaataatatttcttctgttttgtcaagatttaaaaagtggatg
attaccaaaaaatataatatgctatacaaacgagaaagtgatataatgccacaatgggct
ggatcaagttggtattttctcagatatattgattcaaaaaataaaaaacgaatatttaat
aaaaaaaaaattaactcatggctacctgtagatttatatgttggaggaagtgaacatgct
gttttgcatttattatattcgagattttttcataaattcttatatgatttgaaattaacc
aaacacaaagaaccttttcaaaagctatttaatcaaggacttctgttaaatacaacctca
ttctatttatataccaccttagataataaacctgttagttttgatcaaattaatgaaaag
aaaataaatactaatgcatacgattatacaaatcgaggcacaaatcatcatatccaacta
aataaaaaagaaaacgaaaaaaaaaaaaaaacgtatagccaaaatgtttgtgaaacaact
aatttattaacgagtcaggttttacctgaccatgcaagcttttgttcaggtgatcaaaat
ggaaatataaataaagaattaaaaaatgaaagaaatgaaaatatgaaagaaaaggacata
gatattttgagaaaaagtaaaataaatgatgatatgaaagaaaaggcgatagatatgttg
ggaaaaaatagaataaatgatgatatgaaagaaaaggcgatagatatgttgggaaaaaat
aaaataaatgatgatatgaaagagaatgtgatagatatgttgggaaaaaataattacaca
atagttgataataagtataagaaatttttaattgaagaagattatgtaaaggaaggaaag
gatcagaaatattatttgaagagttttccgtccatcgaagtacaaccaaattacgaaaaa
atgtctaaatcgaaagggaacacgataaacccattagatatagtaaaaacatatggatca
gattgtttacgattacatatattatttttaggtcccgtagatcaaaataagaaatggaca
actaaaggaataaaaggaacgtttaagtttttaaataatttatataatttatttatacaa
agatgtgatataaaaaataataaagagagtaataaaaagaatgtgtgcacacgtgtagta
gataatagtatgaatgatatgatgttccataaagataatattgagaaaagtgctaaccac
attttatcaaataatggatatgaaaaaaagaaaaagataaatttagaaaatggagaaaaa
aaaatagaatatatgatttgtaaaaattgtaagaggaagagtagtaataaaaaattaatt
ttaaattttttaaaaaataaatatgggtttataatagcaaatgaaaaatataaaaaagta
aatgattatgtaaacataatattaaaaaatgattcacatgtatttaataaattatctgat
aaaataaaaaagataaaaatagaagatattgaaaatgaaaagaaaaaaaaagtaaattat
tatatagaaaaaattacgaattgtattaatgatataaaattaaatacagctgtatctttt
tttatgaaattctataatgaaataaaaacatgggatattgttcctttaaaaatatttatt
atatttgtaaaattgttatatccattttgtccacatatttgtgaagagttttggttttat
tatttaaaaagatataaaattaaaaaaagaaaaaaactatgttatttctgtaattcaaat
ttgttatattatggaaagtggccttccttattcgaaataaaacaaaacaaattggtcaac
atatctataaaactgaataacaagcatataacatttcttcagagggatgtatctagtacc
tctgacataacagaagaagcaactaacttgataaaacataaaatcgaaaatgaaatgaaa
aaggggaagaaaattgttaacatagtaaatattccaaataaagtaataaattttataatt
aaatag

DBGET integrated database retrieval system