KEGG   Plasmodium falciparum 3D7: PF08_0018Help
Entry
PF08_0018         CDS       T00095                                 

Definition
(RefSeq) translation initiation factor-like protein
  KO
K02519  
translation initiation factor IF-2
Organism
pfa  Plasmodium falciparum 3D7
Brite
Translation factors [BR:pfa03012]
 Eukaryotic Type
  Initiation factors
   MTIFs
    PF08_0018
 Prokaryotic Type
   PF08_0018
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PF08_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1173466..1177659
Genome map
AA seq 1397 aa AA seqDB search
MNKIKIRKFEDPHVWIYENVLLNKTLKLKEIEKKKDNKNVPNALLHEEACKKLKGILKEC
KKYDKELQEIKNKKESFILKNTLHPNKKINLKFLLNDNQFKVKNEEERKNFKLIFNENKN
IYIKNNQKVYNNIINIKRNSQITSTNNMNNNNNNVNINNDNIQPTNNLLNNIKKIQKEKI
SKLYSVFNNHVNYYDNYLKEKYMKEEYLSNVKYEYVSPHRHNYNDHDIKPDVIYKEDSNV
SNTTHNNHNNNNNNNNNSKNKNNFSSSISSSDLLYHTNLGKNNSVSGTNLKLNVHTNNIH
ILDNKQCYDTLHHNNAYSHDIYGNQENVNTPKDKYITKINNKNVEDMKNVTNNIIFNKLN
INNENTQKIFLYNRNDKEHESIKNDKNNSKDYPFDYKKETSYLTTEENCNHIDIYDDNKM
CDDNIYVKRNVYHNKNNSVKDLFVKSFNILNTINQTSLYDKQNDDVSNEDANRNVLNGSV
LSILNELRENKVKEKNKIGEYKKDNTLHKDDEKVSVSRIHTYEMKQKEVTNVNKNESFYS
YGINNNNNNYYYNYNNCNNLKESVVPHKKKENHKNKHIKQYEYLDSNNITINSLSNHLDV
DDEKIINVCKYILDNDYIYKYTKIEKEVAELICEELNVSEKLKFSCINLKKRNPIVTILG
HVDHGKTTLLDRLRHSNIADNEIGGITQKLGAFEVVCRDDEMKENKNVKEYINDNKKEEH
NHYNKKEEHNNYNKKEEHNNYNKKDEHNNYNKKEEHNIYCDNSSNYHNRKITFFDTPGHS
VFRTIRKRCVQCSDLIVLVISLDDGIMSETIECIELAKTYNTPLIIAANKIDKFHKNIEE
LSKSLLNYNIVTNLENGDVPMVPISAKKNINIDILKKQILHVSNKLNLMCDYGSLCSAYI
LEKKVDPSKGKLLTVICKSGTLKVNTYFIIGHIYGKIKRIYNSNNEIVSQAYPSEVVQII
SSIPLSYDNINYGDIMLEMNTLKSAQKVSKYKLKLVQYNLINDHYNMNNTLGEISRNIET
NKNNDIHNNDNNLDDNIIDELHNDISIYDGNKKKKNSNKLDINKKYNNNNKKYNNNNNNN
NIYNNNIYNNNNIYNIYNNNNNKYYNNHSNDLRNPLNKFNSKNNNLSGSNFNLNSFKLPQ
IPLILKTCDEGSLEGIMEGIEHFNKNETKEKYCNIHNFIDRNYINKNMLNDDINNISKEL
FSNWCPLKIINKGLGTFHSTDLKYCEHINPCFLISFNVDIDFKLLQPYIENHNIILRNHN
IIYELFNDIENMCNFYFDSLHVYEPVAKMIINKTGYYSIKKNKTKKVVISVDIKEGSFTS
NEYFTLKRNKQIIHNKIHILSMQKNKQNTNELNKSCNINAIIFNINSDDFEVGDEIVAYK
KVVRSPLFNTIKSFDLS
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagataaaaataagaaaatttgaggatccacatgtttggatatatgaaaatgta
ttattaaataaaacattgaaattaaaagaaatcgaaaaaaagaaagataataaaaatgtt
ccaaatgcattattgcatgaagaagcttgtaagaaattaaaaggcatattaaaagaatgt
aaaaaatatgacaaagaattacaagaaattaagaataaaaaagaatcctttatattaaag
aatactttacatccaaataaaaaaattaatttaaaatttttattgaatgataatcaattt
aaagtaaaaaatgaggaagagaggaaaaattttaaattaatttttaacgaaaataaaaat
atctatattaagaataatcaaaaagtatataataatataataaatataaaaaggaacagt
caaataacctctaccaataatatgaacaataataataataatgtaaacatcaataatgat
aatatacaacctacgaataatttattaaataatattaaaaaaatacagaaggaaaaaatt
tccaaattatattcagtttttaataatcacgtaaattattatgataattatttaaaagaa
aaatatatgaaggaggaatatttatcaaatgtaaaatatgaatatgtatctccgcatcgt
cataattacaatgatcatgatataaaacctgatgttatttataaggaggattccaatgtg
tctaacacaacccacaataatcataacaataataataataataataataatagtaaaaat
aaaaataattttagtagtagtatttcttcttctgatcttttgtatcatacaaatcttggt
aaaaataattcagtgtcgggtacaaatttaaagttaaatgtacacactaataatatacac
attttagataataaacaatgttatgatacgcttcatcataataatgcttattcacatgat
atatatggtaatcaggaaaatgtaaatactccaaaagataaatatataacaaagatcaat
aataaaaatgttgaggacatgaagaatgtgacaaataacattatattcaacaaattaaac
ataaacaatgaaaatacccaaaaaatttttttatacaataggaacgacaaagaacatgaa
tctataaagaatgataaaaacaattctaaggattatccttttgattataagaaagaaaca
tcctatttgacgacggaagaaaattgtaatcatatagatatttatgatgataacaaaatg
tgtgatgataatatatatgtgaaaagaaatgtctaccataataagaataatagtgtgaaa
gacctttttgtaaaaagtttcaatattttaaatacaataaaccaaacctccttgtacgac
aaacaaaatgatgatgtatcaaacgaggatgcaaacagaaatgttttgaatggtagtgtt
ttatccatattaaatgaattaagggaaaataaggtaaaagaaaaaaataaaattggagaa
tataagaaggataatacattacacaaggatgatgaaaaggtttctgtgagtaggattcat
acatatgagatgaaacaaaaagaagtgaccaatgttaataaaaatgaatccttctattca
tatggtataaataataataataataattattattataattataataattgtaataatttg
aaggagagcgtggttcctcataaaaaaaaagagaaccataaaaataagcacattaaacag
tatgaatatttagatagtaataatataacaataaattctttaagtaaccatttagatgta
gatgatgaaaaaataatcaatgtatgtaaatatatattagataatgattatatatataaa
tatacaaaaattgagaaagaagtagctgaattaatatgtgaagaattaaatgtctcagag
aaattaaaatttagttgtatcaatttaaaaaaaaggaatcccatagttactatattaggt
catgtagatcatggtaagacaactttattggatcgattaagacattctaacatagcggac
aatgagataggaggtattactcaaaagctgggagcatttgaagtagtatgtagagatgat
gagatgaaagaaaataaaaatgtaaaggaatatattaatgataataaaaaggaagaacat
aatcattataataaaaaggaagaacataataattataataaaaaggaagaacataataat
tataataaaaaggacgaacataacaattataataaaaaggaagaacataatatttattgt
gataattcttctaattatcataatagaaagattacctttttcgatacgccaggacattcc
gtattcagaactataaggaaacgatgtgtacaatgtagtgatttgatcgtattagtaatt
tccttagatgacggaattatgagtgaaaccattgaatgtattgaactagccaaaacgtac
aatacaccacttattatagctgcaaataaaattgataaatttcataaaaatattgaagag
ctttcaaaaagtttattaaattataatatcgttactaatttagaaaatggggatgttccc
atggttccaatatctgccaaaaaaaatataaatattgatattttaaaaaagcaaatttta
catgttagtaataaattaaatttaatgtgtgattatggatctttatgttcagcttatata
ttagaaaaaaaagtggacccttctaaagggaaattattaactgttatatgtaaatctgga
acattaaaagttaatacatattttataattggacatatatatggaaagatcaaaagaata
tataatagtaataatgaaatagtatcacaagcatatccttcagaagttgtacaaatcata
agttcaattcctttatcatatgataatataaattatggtgatattatgttagaaatgaat
actttgaaatctgctcaaaaagtatctaaatataagttaaaattagttcaatataattta
ataaatgatcattataatatgaacaatactttaggtgaaatatctagaaatatcgaaaca
aataaaaataatgatattcataataatgataataatttagatgataacattatcgatgaa
ttacataatgatatatctatatatgatggtaataaaaaaaaaaaaaattctaacaaattg
gatattaataaaaaatataacaataataataaaaaatataacaataataataataataat
aatatatataataataatatatataataataataatatatataatatatataataataat
aataataaatattacaataatcatagtaacgatttaaggaatccattaaataagttcaat
agcaagaataataatttgagtggttctaattttaatttaaattctttcaagttaccgcaa
atacctttaattttaaaaacatgcgatgaaggtagtttagaaggtataatggaaggaata
gaacattttaacaaaaatgagactaaagaaaaatattgtaatatacataattttatagat
aggaattatataaataagaatatgttaaatgatgatataaataatatatctaaagaatta
ttttcaaattggtgtcctttaaaaattataaataaaggattaggtacatttcatagtaca
gatttaaaatattgtgaacatataaatccatgctttcttatttcatttaatgttgatatt
gattttaaattattacaaccatatatagaaaatcataatattattttaagaaatcataat
attatatatgaattatttaatgatatagaaaatatgtgtaacttttattttgattcttta
catgtctatgaaccagtcgcaaaaatgattataaataaaactgggtattattctattaaa
aaaaataaaacaaaaaaagttgttatatccgttgatataaaagaaggatcatttacatcc
aatgaatattttacacttaaaagaaataaacaaattattcataataaaatacatatactt
tctatgcaaaaaaataaacaaaatacaaacgagctaaacaaatcatgtaatattaacgcc
atcatatttaatattaattctgatgattttgaggtaggcgatgaaattgtggcttacaaa
aaggttgtaaggtcccccctctttaacacaataaaatcatttgacctttcataa

DBGET integrated database retrieval system