KEGG   Plasmodium falciparum 3D7: PF08_0020Help
Entry
PF08_0020         CDS       T00095                                 

Definition
(RefSeq) Ubiquitination-mediated degradation component, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1153374..1157354
Genome map
AA seq 1326 aa AA seqDB search
MVDKIKEDAIIQNTFQICLKKEECNNNKLYLESYVKELKENNEELYFLLDNLYFILLHKI
SDLHRQKKNCLSYLCSCASRLVDKSLYKGINMNNKESDIIINEISDQIVNSVIIYLENLD
IYPNMKISKKERMEVFYEFLKKSCTSRFLKKLLSFIEENDKNEDDENSKQLNKFFNPIID
LILSNLNNRNLVYPKNDVAVLFSFLTGFKPIADLITHNKSMFLYINVNDRMKDNMNCDIK
KESDKNLLSTCKSMPVNTTDSSTNNITTNRSNNSNGNNDVPQEGPTTTNSNNNNANNNLS
NNNLSSNNLSNNNLSSNSIIRRSVPYAHFHSTIIQNSYSRFSRDKEISTCGYNFQLNSLL
GRLISPTIINMPNILKKEEIAMYKYFFNSNTNSLNKMTLNGLKNTYTLLRKDTDWILENC
VEIIKNLLKSSSDSKKIILLWINCILISNEKKTKIMYHYSTYPQSLDTSYGLFLKLLGEN
SYGFCLNMFWVLLCLCEPITVNKINDLDFFFFLRNDPFSKFLLKNITNQSSFEDKSNVEK
IKKNVERSECFQKEPKFITCIFWMTFKSLSVFFKPAVDEFIKIVQEAGNAKDKDFYYMNI
HAWKIFLYNTRFNQLLFKFLHLCMNYFLHVAYVYDINGNINNSMKTCLNEHNNSLVHLVL
KCCPPPNEKYYNNTKEGTTEGTNIVSHMRENEKVERNEPIGENKRIENNDGVVENNQMNE
SGRNGSLDEDLNRDEREGINISNESNNRVSLGINNNEENTPMVISPLDGSDDRLYASPHF
SIIPTFFLSDIFEILYLLYELDLFKSPNNETLMNYLDIDLFLAFSIFTMLSENHIKSIHL
RCESAPKTFSFLYKLDNLKKVIEESELTKKYIIKSLTNVFIASQKGEYTERMQTRVRIVE
NFNSFFLNKTYVNQFTQLVINNNNLFVHLIHLLLNDVSFLVEEVVSYLSEIKRREENNKK
KKDSQQENEQEANSNSYLNATTRNNRTSNGSSNSVANLNYSSLNNNNNNNNNNNNNNNNN
NNNNSNNFNDSSFNSDNNSDDGEEGGMDYDLSNESMRNLAAKTKMIITYCYKSCIFLNLL
CKNYPNNILTSNTILSQIVTCLNCYFDYLVGPKCLNIKVKNMEQYNFRPQLWLTSIVESY
LFLLNSDKEHEELLIREIANEGRYYKAEIFNKAYYICKREGLLHKEELNKFKNFCQEIVD
MKDEVELFNDVDDIPDNFLDPILQDIMLDPVLLPTSGIIIDRKNIERHLMSEPNDPFNRA
PLSKEQLVPMPQLKEEIQNYINKLRQEKKKKKKKIDNIDFDVENEEFPNFHQEQNGEVQK
NETSNM
NT seq 3981 nt NT seq  +upstreamnt  +downstreamnt
atggtggataaaattaaagaagatgctattattcaaaacacttttcagatatgcttgaaa
aaagaggaatgtaataataacaaattatatttagaatcttatgtgaaagaattaaaagaa
aacaatgaggagttatattttttgcttgataatttatattttattttacttcacaagata
agtgatttacatagacagaagaaaaattgcttaagttatttatgttcatgtgcttctcgg
ttagttgataaaagtttatataaaggtataaatatgaataataaagaaagtgatataata
attaatgagatatctgatcaaattgttaatagtgtaattatatatttagaaaatttggat
atatatccaaatatgaaaataagtaaaaaagaaagaatggaagtattttatgaattttta
aaaaaatcttgtacatctcgatttttaaaaaaattattgtcttttatagaagaaaacgat
aaaaatgaagatgatgaaaatagtaaacagttaaataaattctttaatccaataatagat
ttgatattaagtaatttgaataatagaaatttagtgtatccaaaaaatgatgtcgctgtt
ttgttcagtttcttgacaggtttcaaacctatagctgatttgataacacataataagtct
atgtttttatatataaatgtgaatgatcgtatgaaggataatatgaattgtgatataaaa
aaggaaagtgataaaaatttattatcaacatgtaagagtatgcctgtaaatacgaccgat
tcgtctacaaataatataacaacaaatcgtagtaataacagcaatggtaataatgatgtt
ccacaagagggacccacaaccaccaactctaataataataatgcaaataataaccttagt
aataataaccttagtagtaataatcttagtaataataatcttagtagtaatagcatcatc
cgtagaagcgtgccatacgcacatttccatagcaccattatacaaaatagttattcgcga
tttagtagagataaagaaattagtacttgtggatacaacttccaattgaatagcttacta
ggtcgtctaatttcacctacaattattaatatgcccaatatactaaaaaaagaggagatt
gctatgtataaatatttctttaacagtaatacaaatagtttaaataaaatgacactaaat
ggattaaaaaatacttatactttattaagaaaggatactgattggattttagaaaattgt
gtagaaattataaagaacttattaaaaagtagtagtgatagtaaaaagataatattgcta
tggataaattgtattcttatctctaatgagaagaaaacaaaaataatgtatcattattct
acatatccacaatcattagatacttcttatggattatttttaaaattgttaggagaaaat
tcttatgggttttgtcttaatatgttttgggttttattatgtttatgtgaacccataact
gtaaataaaattaacgatttggatttttttttctttctaagaaatgacccgttctctaaa
tttttattaaaaaatattacaaaccaatcgtcgtttgaagataaatcaaatgtcgaaaaa
attaagaaaaatgttgaacgttccgaatgtttccaaaaagagcctaaatttatcacatgt
atattttggatgacctttaaatcattgagtgtattttttaaacctgccgtagatgaattt
attaaaatagttcaagaagcggggaatgccaaagataaagatttttattatatgaatata
catgcgtggaaaattttcctgtataacacacgctttaatcaattattgtttaaattttta
catttatgtatgaattattttcttcatgtagcatatgtatatgatattaatggaaatatt
aataattctatgaaaacttgtttaaatgaacataataatagtttagtacatttggtttta
aagtgttgtcctcctcctaacgagaaatattataataatactaaagaaggtacaaccgag
gggactaatatagtttcccacatgagggaaaatgaaaaagtggaaaggaatgaacctatt
ggagaaaataaaagaattgaaaataatgatggggttgtcgaaaataaccaaatgaatgaa
tcaggaagaaatggttccctagatgaagaccttaatagagacgaaagagaaggaatcaac
ataagtaatgaaagtaataatagggtatcattaggtataaataataacgaagagaatacc
ccaatggtgataagtcctttggatggatcagatgatcgtttatatgcatctccacacttt
tctataatacctactttttttttaagtgatatatttgaaattttatatttattatacgaa
ttggatttatttaaaagtccgaataatgaaacattaatgaattatttagatatagatttg
tttttagccttttctatatttacaatgttaagtgaaaatcatattaaaagtattcattta
agatgtgaatcagctcctaaaacattttcatttttatataaattagataatttaaaaaaa
gtaattgaagaatctgaattgactaaaaaatatataataaaatcattaacaaatgtattt
atagcttcacaaaaaggagaatacacggaaagaatgcaaacacgtgtacgtatagtagag
aactttaatagtttctttttaaataaaacatatgtaaatcaatttacacaattagtaata
aataataataatttatttgttcacttgatacatttattattaaatgatgtaagttttcta
gttgaagaggttgtgtcttatttatctgaaataaaaagaagagaagaaaataataagaag
aaaaaggattcccaacaagaaaatgaacaagaagcaaattcaaattcttatttaaatgcg
actacaagaaataatagaacatcaaatggaagtagcaattctgtagcaaatttaaattat
tcatctttaaataataataataataataacaataataacaataataataataacaataat
aataataacaatagtaacaattttaatgattcctcatttaatagtgataataatagtgat
gatggagaagaaggtggaatggattatgatttatcaaatgaaagtatgagaaacctagca
gccaaaacaaaaatgattataacatattgctataagtcatgtatatttttaaatttatta
tgtaaaaattatccaaataatatacttacatccaataccatactatcacaaatcgttaca
tgcttaaactgttattttgattatttagttggtcccaaatgtttaaatatcaaagtaaaa
aatatggaacaatataattttagaccacaattatggctcaccagtatagtagaatcttat
ctattcttattgaattctgataaagaacacgaagagttgttaattagagaaatagcaaat
gaaggaagatattataaagctgaaatttttaataaagcttattatatatgtaaaagagaa
ggattgttacacaaagaagaattaaataaatttaaaaacttttgtcaagaaattgtagat
atgaaagatgaagtagagttatttaatgatgttgatgatatacctgataatttcttagat
ccaattctacaagatattatgttagatccagttcttttacctacatctggtattattatt
gacagaaagaatattgaaaggcatttaatgagtgaacctaatgatccatttaatagagcc
ccactttcaaaagaacaactagtacccatgccacagctaaaggaagaaattcaaaattac
ataaataaattaagacaagaaaaaaaaaaaaaaaaaaaaaaaatcgataatatagacttt
gatgtagaaaatgaagaattcccaaattttcatcaagaacaaaatggagaagtgcaaaaa
aatgaaacttcaaatatgtaa

DBGET integrated database retrieval system