KEGG   Plasmodium falciparum 3D7: PF08_0021Help
Entry
PF08_0021         CDS       T00095                                 

Definition
(RefSeq) SPRY domain, putative
  KO
K14964  
Set1/Ash2 histone methyltransferase complex subunit ASH2
Organism
pfa  Plasmodium falciparum 3D7
Brite
Chromosome [BR:pfa03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     PF08_0021
    MLL-HCF complex
     PF08_0021
    MLL3/MLL4 complex
     PF08_0021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1147239..1148576
Genome map
AA seq 445 aa AA seqDB search
MASTINFFSKEDISNKEENEKEEKKSNNKELLENNKEKSCSGIQKTIRLLNLFSNSEKKR
KIDNSREEYSDKILEKQSTLSLKDKEQNALNYINNEYVIEKGNDKLCEEQGQDHQISIAS
LEDEGSYNKNVTTFERNESNNEKMKDIKNDDIKIKEKINYNKINNDRITYDGKSKKGEEK
NKYSKEKTNTHLHVEVEKKDNIKHFFDYNKYRSKCNVTFSMKYKDSSVSLSNDKLTCYGD
KGWSSVFVNNGADIGKWYYEIKIEEPVQNFNFLGYKDKIIKVNPYIRVGFACRYMRYDYP
IGTDKYSYCVNSKNGKIFNNSISYDCMEPFNVGDIIGCYLNLKNKNSYNFDPRLDKKLYE
HLQNGILCDPKNPPLLKKNEGSTIFFSLNGQIKKTSFMDIYEGFYHPSVSLYMGASAKIN
LGPNFTYNHLQDYVPCVYMEPPTVL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcctcaacgataaattttttttccaaagaagacattagtaataaggaagaaaatgaa
aaagaggaaaagaaatcaaacaataaagaattgttagaaaataataaagaaaagtcctgt
tctggtatacagaaaactattagattattgaacttatttagtaatagtgaaaagaagagg
aaaattgataatagtagagaagaatattctgataaaatattagaaaaacaaagtacatta
agtttaaaagataaagaacaaaatgctttaaattatataaataatgaatatgtgattgaa
aaaggaaatgataaattatgtgaggagcagggacaagatcaccaaatttctatagcttct
ttggaggatgagggatcatacaataaaaatgttacgacttttgaaaggaatgaatctaat
aatgaaaaaatgaaggatataaaaaatgatgatataaaaattaaggaaaaaattaattat
aataaaataaataatgatagaataacatacgatggcaaatcaaaaaaaggggaagaaaaa
aataaatatagtaaagaaaagacaaacacgcatttacatgtagaagtagaaaaaaaggat
aatataaaacatttctttgattataacaaatataggagtaaatgtaatgtaaccttttca
atgaaatataaagatagttctgtaagtctaagtaatgataagttaacttgttatggtgat
aaaggatggtcaagtgtttttgtaaataacggtgcagatattggaaaatggtattatgaa
ataaaaattgaagagcctgtacaaaatttcaattttttaggatataaagataaaattata
aaagtcaatccatatataagagttggttttgcttgtagatatatgagatatgattatcct
ataggtacagataaatatagttattgtgttaatagtaaaaatggtaaaatatttaacaat
tctattagttatgattgtatggaaccttttaatgttggtgatattattggatgttattta
aatttaaaaaataaaaattcatataatttcgatccaagattagataaaaagctatatgaa
catttacaaaatggaatattatgtgatcccaaaaatccacctctcttaaaaaaaaatgaa
ggttcaactatattcttttctttaaatggacaaataaaaaagacatcctttatggatatt
tatgaaggattttatcatccttctgtaagtttatatatgggagcatcagctaaaattaac
ttgggccctaattttacatataatcatttgcaggactatgtcccatgtgtatatatggag
cctcccaccgtattataa

DBGET integrated database retrieval system