KEGG   Plasmodium falciparum 3D7: PF08_0025Help
Entry
PF08_0025         CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
  KO
K18178  
cytochrome c oxidase assembly factor 5
Organism
pfa  Plasmodium falciparum 3D7
Brite
Mitochondrial biogenesis [BR:pfa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    PF08_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1101888..1102145)
Genome map
AA seq 85 aa AA seqDB search
MLNVRPDKPHRKASNSCSKLLNDMIACYQNTICYKKDNSNFLDCLHNHNLNEIDENCIIL
RKAYAQCRRNLLNGNFKIKGNPLSR
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgctcaatgttagacctgacaagccacatagaaaggcctcaaattcatgtagtaaactt
ttaaatgatatgattgcttgttatcagaatacaatttgttataaaaaggataactcaaat
tttttagattgtcttcacaatcataatttaaatgaaattgatgaaaattgtattatttta
agaaaagcctatgcccaatgtcgtcgtaatttgttgaacggaaatttcaaaatcaaggga
aacccattatcaagataa

DBGET integrated database retrieval system