KEGG   Plasmodium falciparum 3D7: PF08_0026Help
Entry
PF08_0026         CDS       T00095                                 

Definition
(RefSeq) conserved protein, unknown function
  KO
K14786  
protein KRI1
Organism
pfa  Plasmodium falciparum 3D7
Brite
Ribosome biogenesis [BR:pfa03009]
 Eukaryotic Type
  90S particles
   Other 90S particles
    PF08_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:1099556..1101448
Genome map
AA seq 630 aa AA seqDB search
MGKNKKRKNSRDINSCDNNIGVNKEKDNVINYNDIDKNLQKGDMENMNSFDDNKEEIENN
NNNNNNNQEEGLINGLKNNKMNDKIIEEKEDEISVSDDNSSSSDEDHEGLLLTSKFKKKF
SYLLLKLKSKDSNLLDKNNDNFFHDSDFETELSSDEESKEDENNDERKKKRMKLHHNVDD
NNHNDDNHNKDDNKKERDMLNYSEYYKDILLKEGSQAFEKEEEELLNKEKELSSKKNKKT
YLDEQEELKKQIQEACKIADEQNDNIFDDNFFTIKEKSEQELLEEKKYYETFLKTSNMMK
EENNLLKEYWKDNLSKDEEFLRDYILKEMWREDKVQNIYEEIDEIDDEELEKAENFERTY
NFRYEEQNGNMINSIPRKIESSVRQDIKKKKKKEKRREKKKKLKEKKKKLLLDNLKNDEK
DEEKNKKSNKINNNVYNTSGIKNNDQNMDNMNQKGKSNKNSNKYNFDEEDLWFLCDLCNN
PISPLCYVYECNICDNFALCKKCYKKNKHEHNLKKILVPRHCIPPQDYQNEELIAKDGQI
NNNNNNNNNNNNNNNIYDNNLMEYLENDSSAYEDLIDDMPIRFKYIKVKPRSFKLSTDYI
LNTDDSTLNKVVPLKKVLPYYENKKKLVDT
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaataaaaaaagaaaaaattcaagagatataaattcatgtgataataatatt
ggagttaataaggaaaaagataacgttattaattataatgatattgataaaaatttacaa
aaaggtgatatggaaaatatgaattcttttgatgataataaagaagaaatagaaaataat
aataataataataataataaccaagaggaaggtcttataaatggtttaaaaaataataaa
atgaatgataaaataatagaagaaaaagaagatgaaatatctgtaagcgatgacaatagt
tcaagtagtgatgaagatcatgagggcttattactaacatccaaatttaaaaaaaagttt
agttatttattattaaaattaaaaagtaaggattcaaatttattagataaaaataatgat
aatttttttcatgatagtgattttgaaacggaattatcaagtgatgaggaatctaaagaa
gatgaaaataatgatgaaaggaaaaaaaaaagaatgaaattacatcataatgttgacgat
aataatcataatgatgataatcataataaggatgacaataaaaaagaacgtgatatgttg
aattattccgaatattacaaagatattttattaaaagaagggtctcaagcttttgaaaaa
gaagaagaagaattattgaataaggaaaaggaattaagttcaaaaaaaaataaaaagaca
tatttggatgaacaagaagaattaaaaaaacaaatacaagaagcatgcaaaattgcagat
gaacaaaatgataatatatttgatgataacttctttaccataaaagagaaaagtgaacag
gaattattagaagaaaagaaatattatgaaacctttttgaagacttctaatatgatgaaa
gaagaaaataatttattaaaagaatattggaaagataatttaagtaaggatgaagaattt
ttaagggattatattttaaaagaaatgtggagagaagataaagtccaaaacatttatgaa
gaaatagatgaaattgatgatgaagaattagaaaaagcagaaaattttgaaaggacatat
aattttagatatgaagaacaaaatggaaatatgattaattctataccccgtaaaatagaa
agtagcgtaagacaagatattaaaaaaaaaaagaaaaaagaaaaaagaagagaaaaaaag
aaaaaattgaaggagaagaaaaagaaattacttttagataatttgaaaaacgatgaaaaa
gatgaagaaaaaaataaaaaatcaaacaagataaataataatgtatataatactagtggt
ataaaaaataatgatcaaaatatggataatatgaatcaaaaagggaaaagtaacaaaaat
tcaaataaatataattttgatgaagaggatttatggtttttatgtgatttatgtaataat
cctataagtccgttatgttatgtgtatgaatgtaacatatgtgataattttgctttgtgt
aagaaatgttataaaaaaaataagcatgaacacaatttaaaaaaaatattagtacccaga
cattgcataccgccacaggattatcaaaatgaagaattgatagcaaaagatggacaaatt
aataataataataataataataataataataataataataataatatatatgataataat
ttaatggaatacctagaaaatgattcaagtgcatatgaagatctgattgatgatatgccc
attagatttaaatatatcaaagtgaaacctagatcatttaaattatccactgattatatt
ttgaatactgatgattcaacattaaataaagttgttcctttaaaaaaagttttaccttat
tatgaaaataagaaaaaattagtagatacatga

DBGET integrated database retrieval system