KEGG   Plasmodium falciparum 3D7: PF08_0027Help
Entry
PF08_0027         CDS       T00095                                 

Definition
(RefSeq) conserved Plasmodium protein, unknown function
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1081127..1084063)
Genome map
AA seq 978 aa AA seqDB search
MHMKLIDEVLTKWRRKEINLFKVCLYFHCIKKSLKLLEDKNDFFINLINDSIFEEIINLS
KQKITDNNNNSNNNNNNNNSFNDEDKFFFVIFVTFIFNLENEYINDQNKGLLHLINNDNN
KEYEKNIQHNKDKLKQNNKNIRDNSSQNLFNQNKYKKIDILIKNIIDLEISQHISSPPKE
NKFINYKIYAYYAIIQFIFHILQNNDEQAGKIFSKYIKNIFTTLLNINHTILCNENILSL
ANKTLLFIVFINHHLIKDNEKEFFNFLFIQLNKYNEYMLPIIQEIFVTYLKKKKKLMLNK
EIYQYLDNYLNDNISLLLKYGKKENLFFFLNVLSIYKIFIKKYISNNDQNVYTIKNEDNV
HIILNIKHIINNVNKLLEYLVHISKDYIYNNTNIDISLYNQDSIYYNKPEENTNDKRTSY
FVDNIIKEVDKEKYAINSVQSINHEFNTTLVQNYSLYQNNNLFSYITYHICTFFNDISNI
IDTECISINTTYFIHFMKPFLSSHNNEDDLFLTYFLIKHLYTYTENLLKKCPIIFDGFVN
YIMYLFKHINLLTKNNFSITEQTNLINILNKIKNVEHVNDIVDIYCTLYIHLVQNLSLFL
KYLKYYNNEEIKEKILVHYEYFIFHVFHETNNVNFHIIFKNNNAAFVTLKLLYNLLKINN
FHFENIHNIYFKLCKVQNHLQNIHEQNSQHYLYTYQNHMANTNSIFYLNKIKTFLLNNLD
SISNDKKTPFYIANKKKKLKYKSPRQIKNIHHNNNESGLVLSAQESVNSASQIINKQKKK
KKKKDKKKKKKKKKNPLAEIKNPINDVKRSKQEINESNESLDERIDEEIERNSQNSIMDN
NIISYNVNEIEQSQNLGKNEEYTEMEQEQNELNNDMMVTYNVTNNNEHMNKENDKLCNNE
NEYNEFNSISVKNKCDETLKKKMEKKKSLKNKNLDHNNNVAHKNSLEIKTLKENIKMVSS
SDAINSLKFMKQSILNDL
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
atgcatatgaaattgatcgatgaagtattaacaaaatggagaaggaaagaaataaattta
tttaaagtttgtttatattttcattgtataaaaaaaagtttaaaattactggaagataaa
aatgatttcttcataaatcttattaacgattcaatctttgaagaaataataaatttaagt
aaacaaaaaataacagacaataacaataacagtaacaataataataataataataattct
tttaatgatgaagataaatttttctttgtcatctttgtaactttcatttttaatttagaa
aacgaatatataaatgatcaaaataaaggacttctgcacttaataaataatgataataat
aaagaatatgagaaaaatatacaacataataaggataaactaaaacaaaataataaaaat
ataagagataattcttcacaaaatttatttaatcaaaataaatataaaaaaatagatata
cttatcaaaaatattatagatttagaaatatcacaacatatatcatcaccccctaaggaa
aataaatttattaattataaaatatatgcctattatgctattatacaatttatttttcat
atattacaaaataatgatgaacaggcaggaaaaatattttccaaatatattaagaatata
tttacaacgcttttaaatattaaccataccattttatgcaatgaaaatattctatcatta
gcaaataaaacattacttttcattgtatttattaatcaccatttaataaaagataatgaa
aaggaattttttaattttctatttatacaattaaacaaatataatgaatatatgttacct
atcatccaagaaatttttgtaacctatttaaaaaaaaaaaagaaacttatgttaaataaa
gaaatatatcaatatttagataattatttaaatgataatataagtttattattaaaatat
gggaaaaaagaaaatttattttttttcttaaatgtcttaagtatttataaaatatttatt
aaaaaatacattagtaataatgatcaaaatgtgtataccataaaaaatgaagacaatgta
catattatattaaatataaaacatattattaacaatgttaataaattattagaatattta
gttcatatatcaaaagattatatatataataatacaaatatagatatttccttatacaat
caggattctatatattacaacaaacctgaagaaaacacaaatgataaaagaacatcctat
tttgtagacaatattataaaagaagtagataaagaaaaatatgctataaatagtgtacaa
agcataaatcatgaatttaacacaacgttagtacagaattatagtctttatcaaaataac
aacctttttagttatataacatatcatatatgtacattttttaacgatatatcaaatatt
atagatactgaatgtataagtatcaatacaacgtattttatacattttatgaaacctttt
ctttcatctcataataatgaagatgatttatttttaacgtatttcttaattaagcatctt
tatacatacacagaaaatttattaaaaaaatgtccaatcatatttgatgggtttgtgaat
tatattatgtacttattcaaacatataaacctgttaacaaaaaataacttttcaataaca
gaacaaacgaacttaattaatatattgaataagataaaaaatgtggaacatgtaaatgat
attgttgatatttattgtactttatatattcatttggtgcaaaacctttctctatttctt
aaatatttaaaatattataacaatgaagaaattaaagaaaaaattttagttcattatgaa
tatttcattttccatgtattccatgaaacaaataatgttaatttccatattatttttaaa
aataataacgccgcttttgttacattaaagttattatataatcttttaaaaataaataat
ttccattttgaaaatatacataatatatattttaaattgtgcaaagtacagaaccattta
caaaatatacacgaacaaaattctcaacattatttatatacatatcaaaaccatatggct
aatacgaatagtatattttatttaaacaaaataaaaacattcttattaaataatttggac
tctatatccaatgataagaaaacaccattttatattgcaaacaaaaaaaaaaaattaaaa
tataaatcacctagacaaattaaaaacattcatcataataataatgaaagtggattagta
ttgtccgcgcaagaaagtgttaattcagctagccaaattataaacaagcaaaagaaaaaa
aaaaaaaaaaaagataaaaaaaaaaaaaaaaaaaaaaaaaaaaatccgctagctgaaatt
aaaaatcctattaatgacgtgaaaagaagtaaacaggaaataaatgaaagtaatgaatca
ttggatgaaagaatagatgaagaaatagaaagaaattcacaaaatagtataatggataat
aatattatctcatataatgtaaatgaaattgaacaaagtcaaaatttaggaaaaaatgaa
gaatatactgaaatggaacaagagcaaaatgaattaaataatgatatgatggtaacatat
aatgttactaacaataatgagcatatgaataaggaaaacgataaattatgtaacaatgaa
aatgaatataatgaattcaattcaatatctgtcaagaacaaatgtgatgaaaccttaaaa
aaaaagatggaaaagaaaaaatcattaaaaaacaaaaatttagatcataataacaatgtt
gcacataaaaattcattggaaataaaaacattaaaagaaaatataaaaatggtatcatcc
tcagatgctataaattctttaaagtttatgaaacaatcaattttaaatgatttataa

DBGET integrated database retrieval system