KEGG   Plasmodium falciparum 3D7: PF08_0033Help
Entry
PF08_0033         CDS       T00095                                 

Definition
(RefSeq) membrane skeletal protein IMC1-related
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(1038172..1039680)
Genome map
AA seq 502 aa AA seqDB search
MQGETINVPSSSVPYTFEHSKHLKSKILKPIRQEKVVKVPVTQYVEKIVEKEEIKYVNKY
VDVIKPIITYKTKHISKPIYLDKIKYQPKVVEKEKIIHIPKIEYRNKIVEIPVYVHKENI
IEKKVPLIVERVVPVLKVNRVEKEILTNSFEIPEICEMTKDENNIHIGKNVHETNQQISC
NVSEKGNSFVSEINKEKSDIYNIETYRHMQTTNASPKVYSQLEISSSNMDNQNVETLKDK
NNVVDSNDTSDEEEYNEGNLEHKNETRYHEATNEYSNYDFTSEKNQKINDEENNSKELIN
NNNMEENYYDIDERFKDSNISHVSIHLPEEKGIEQQSYEQNYMNSCNNNYNIIESNLGDT
SGSVYNNINTYGTYYSDNMNPQFDKTFVNQSYNGSKGYIQKIMQRNHIPNYSTNTMEHLK
IVEEKHPNSSNLHISNERFSTLPSVYGARSVTGKSNFVPSYANSNGQAIVSVRPATIVEY
VPKSKKYKASLCNFINKCCGNM
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtgaaacaattaatgtaccttcttccagtgttccttacacctttgaacattca
aaacatttgaagagtaaaattcttaaaccaatacgccaagaaaaagtagtgaaggttcct
gttactcaatatgtagaaaaaatagtagaaaaagaggaaattaaatatgtaaataaatat
gtagatgttattaaacctattattacctataaaacaaaacatatttcaaaacccatttac
ttagataaaattaagtatcagccaaaagtagtagaaaaggaaaaaattatacatataccc
aaaatagaatacagaaacaaaattgtagaaataccagtatatgttcataaagaaaacatt
atagaaaaaaaggtccctctaattgtagaacgtgttgttccagtattaaaagtaaacaga
gttgagaaagaaattttgactaatagctttgaaatacctgaaatatgtgaaatgacaaag
gatgaaaataatattcatattggaaaaaatgtgcatgagacaaaccaacaaatttcttgt
aatgtttccgaaaagggaaattcatttgtatccgaaataaataaagaaaaaagtgatatt
tataatatcgaaacatacagacatatgcaaacaaccaatgcatcgcctaaagtttattca
caattggagatatcatcttccaatatggataaccaaaatgttgaaacattaaaagataaa
aataatgtagttgatagtaatgatacttctgatgaagaggaatacaatgaaggaaacttg
gaacataaaaatgaaacaagataccatgaagctactaatgaatattctaattatgatttt
acatcagagaaaaatcaaaagataaatgatgaagaaaacaattcgaaggaattaattaat
aataataatatggaagaaaattactatgatattgatgaacgctttaaggattccaatata
tctcatgtaagtattcatttaccagaagaaaaaggaattgaacaacagtcctatgaacaa
aactatatgaattcctgtaataataattacaatataatagaatcgaatttaggagatact
agtggttcagtatataataatattaacacctatggtacatattattctgataatatgaac
ccacaatttgataaaacctttgttaaccaatcatataatggctctaagggttatattcaa
aaaataatgcagagaaatcatattcctaattatagtacaaatacaatggagcatcttaaa
atagtagaagaaaaacatccaaattcatcgaatttacatatatctaatgaaaggttttca
acattacctagtgtatatggcgcacgttcggttacaggaaaatctaattttgttccttcc
tatgctaatagtaatggacaagcaattgtatcagtacgacctgcaacaattgtagagtat
gtacctaaatcaaaaaaatacaaagcttcattgtgcaattttattaataaatgctgtggt
aatatgtaa

DBGET integrated database retrieval system