KEGG   Plasmodium falciparum 3D7: PF08_0036Help
Entry
PF08_0036         CDS       T00095                                 

Definition
(RefSeq) Pfsec23
  KO
K14006  
protein transport protein SEC23
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Protein processing in endoplasmic reticulum
Module
COPII complex
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PF08_0036
Membrane trafficking [BR:pfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    PF08_0036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(998127..998426,998622..1000601)
Genome map
AA seq 759 aa AA seqDB search
MDIHAQENQTGIRFSWNLWPPTKAEAAKIEVPLGCLYTVLKRTDDSSVKLVEYEPLKCKT
SNCILNPYCNIDFRNKTWTCPFSNIKNPFPLHYAEHISEKNLPADVMYSNIEYIQPSNVG
DIPPPTFLFVIDTCLLEEELEQLKDSIQQCISLMPGDAYIGIITFGNMCYVHEIGFNDCL
KSYVFKGNKEISAQDLQKQLNLGSRNDPRSSTTSASARRFLQPVSECEYNINMLLEDIQK
DNWPTPPDQRAKRCTGVALSVAIGLLECCCNQLSGRVMMFIGGADTTSPGKIVDTPLSES
LRHHLDLQKENSNARHVKKALKYYVSLANRAVASGHAIDIFACSLDQIGLYEMKVCCEKT
NGFMVMADSFSMNVFKDSFKKIFETDSTEYIKHGYNAKLTVICSKEFRVCGAIGACSSNK
KTANYVSDTCVGEGGTCEWTICALDRQSTIAFYFEIVNQNLASLPPDRQAYLQFQTLYQH
PSGRRRLRVTTISYRFAEPNIAEISQGFDQETAAVIMARFAVLKAETDEPIDVLRWLDRK
LIRLVSTFADYQKDDINSFHLSSEFSIYPQFMYHLRRSHFLQTFNASPDETAYYRSILLR
ENVMNSLIMIQPALLQYSFDSPTPIPVLLDAQSLKSNVILLLDSYFHIVIWYGEMIYQWR
EQGFHEKPEYEHFRQLLNAPHEDAKSILEDRFPIPKFVLCNSGGSQSRFLLAKVNPSTTH
NSLSGSTFGTSSNESYIINTDDVSLKIFMDHLVKLAVQT
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggatatacatgcacaagagaatcagacgggtattcgttttagctggaacttatggcca
cccacaaaagcagaagcagcaaaaatagaagtacccttagggtgtttatatacagtatta
aaaaggacagatgatagtagcgttaagttagtagaatatgagcctttaaaatgtaaaact
agtaattgtattttaaatccttattgtaatattgattttagaaataagacatggacatgt
cctttctcaaatatcaagaatccatttcctttacattatgcagagcatatatcagagaag
aatttgcctgccgatgttatgtactccaatattgaatacatccaaccttccaatgtagga
gatattccccctccaacgtttttattcgtcatcgatacttgtttactagaagaagagcta
gaacaattaaaagattcaattcaacaatgtattagtttaatgcctggggatgcttacata
ggtataattacttttggtaatatgtgttatgttcatgaaattggttttaacgattgtttg
aaatcttatgtatttaaggggaataaagaaataagtgctcaagatttacaaaaacaatta
aatttaggtagtagaaatgatcctcgtagttccacaacatctgcttctgctcgtcgattt
ttacaacccgttagtgaatgtgaatataatataaatatgttattagaagatatacaaaaa
gataactggccaactccaccagatcaaagagctaaaagatgtaccggtgtagcattgagt
gttgctattggtttattagaatgttgttgtaatcaattaagtggtcgtgttatgatgttt
ataggtggagcagatactacttcccctggtaaaattgtagatacgcctttaagtgaatcg
ttaagacatcatttagatttacaaaaagaaaattcgaatgctagacatgttaaaaaagct
ttaaaatattatgtatcactagctaatagagctgtagcatctggtcatgctattgatata
tttgcatgttcattagatcaaataggtttatatgaaatgaaggtttgttgtgaaaagaca
aatggttttatggttatggcagattcattttctatgaatgtatttaaagattcttttaaa
aaaatatttgaaacggattcgacggaatatataaaacatggttacaatgcaaaattgacg
gttatttgttcaaaagaatttagagtatgtggtgcaatcggtgcatgttcaagtaataaa
aaaacagctaactatgtatctgatacgtgtgttggagaaggtggtacatgtgaatggact
atatgtgcattagatagacaatcaacaattgctttttattttgaaatagtaaatcagaat
ttggcttccttacctccagatagacaagcgtatttacaattccaaacattatatcagcat
cctagtggaagaagaagattacgtgttactacaatatcttatagatttgcagaacctaat
atagcagaaatatcgcaaggttttgatcaagaaactgctgctgttattatggctcgattt
gctgtattaaaagcagaaacagatgaacctatagatgtattaagatggcttgatagaaaa
cttattagattagttagtacttttgcagattatcaaaaagatgatattaattcttttcat
ttatcttccgaattttctatatatcctcaatttatgtatcatttaagaagatctcatttt
ttacaaacgtttaatgcaagtcctgatgaaacagcatactatagaagtatattattaaga
gaaaatgttatgaattcattaattatgatacagccagcattacttcaatattcatttgat
tccccaactccaataccagtattattagatgcacaatctttaaaatcaaatgtaatactt
ttattagattcatatttccatatagttatatggtatggagaaatgatatatcaatggaga
gaacagggttttcatgagaagccagaatatgagcattttagacaattattgaatgcacca
catgaagatgctaaatccattttagaagatagatttcctatacctaaatttgttttatgt
aatagtggtggtagtcaaagtagatttttattagctaaggtgaatccatcaacaacacat
aattcgttaagtggtagtacctttggtacatctagtaatgaatcttatataattaataca
gatgatgtttctttaaaaatatttatggatcatttagtaaagttagcagtacaaacttaa

DBGET integrated database retrieval system