KEGG   Plasmodium falciparum 3D7: PF08_0038Help
Entry
PF08_0038         CDS       T00095                                 

Definition
(RefSeq) mitochondrial ribosomal protein L4 precursor, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(979872..981450,981581..981708)
Genome map
AA seq 568 aa AA seqDB search
MHLTNKLTKNISFFYHVPLFQKRKLTTFALRKKYIWKNNTHTKKNDEKKIMTCSGDFIEK
KKKNYEWEIERKEEEEEEEEEQDEECSENDIEVMNKEVACNINNDIKIKENNKINVDDDI
SVCDEYKFLFERPKHFAHIDDEPIIRRPGCIIDIKTLLRNNWSFPAVGFNSKLEIPIYKF
EADENDDNIKYISVPNDIFGLPIRSDILHKCYYFYRTALAGYTERMQLYKWEWPGSTKKY
RSQKKSGKARMNWRKTCGRYLGVKNHPIRPFDQKTNINRKFLWKGMKILLSAKFAQDQIK
VVDNFLIKSHKTKYTVKYLRNILGKNCNSALLVHEGKTDVNDNFLWACANIASVKRENVE
GVNIYNLLKYRYVVFTYKALKNIIYELKIYPYKMKWLPTYATPNNTQAPIPEKVKNWNFL
WLEKKKRNNFSKFDKETLKKRIQEWKWSSDIKGALKVKKHDPYKNFILTKFQCNDPVPEY
IKYEYLFNVDDDPHEDNDYEEHFHMLDEILNDDEDLPTISSLSSLQGLEKDDNVQSEEHY
EDDIYNDEGVNDINEDELGNINFEDTKD
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcatttaacaaataaactgacaaagaatatttcctttttctatcatgttccattattt
caaaaaagaaaattgacaactttcgctttaaggaaaaaatatatatggaaaaataataca
cacacaaaaaaaaatgatgagaaaaaaattatgacttgttcaggtgatttcatagaaaaa
aaaaaaaaaaattatgaatgggaaattgaaaggaaagaagaagaagaagaagaagaagaa
gaacaggatgaagaatgttcggaaaatgacattgaagttatgaataaagaagtagcatgt
aatattaataatgatattaaaattaaagagaataataaaataaatgtggatgatgatata
tccgtatgtgatgaatataaatttctttttgagagaccaaaacattttgctcatattgat
gatgagccaattatcagaagacctggatgtattattgatataaaaacattattaagaaat
aattggagttttcctgctgttggttttaatagtaaattagaaattccgatatataaattt
gaagcagatgaaaacgatgataatataaaatatataagtgttccgaacgatatttttgga
ttaccaataagatcagatatattacataaatgttattatttttataggacggctttagct
gggtatactgaaagaatgcaattatataaatgggaatggccaggtagtactaaaaaatat
cgaagtcaaaaaaagagtggtaaagcaagaatgaattggagaaaaacatgtggtagatat
ttaggtgtgaaaaatcatcctataagaccttttgatcaaaaaactaatataaataggaaa
tttttatggaaaggtatgaaaatattattatcagcaaaatttgctcaagatcaaataaaa
gttgttgataactttttaattaaatctcataaaacaaaatatactgtaaaatatttaaga
aatattctaggaaagaattgtaatagtgctttgctagttcatgagggaaaaacagatgtg
aatgataattttttatgggcatgtgctaatatagcaagtgtaaaaagagaaaatgtggaa
ggagttaatatttataatttattaaaatatagatatgttgtgttcacatataaagcttta
aaaaatattatatatgaattaaaaatttatccatataaaatgaaatggctacctacctat
gcaactcctaataatacccaagcaccaataccagaaaaagtgaaaaactggaatttttta
tggttagaaaaaaaaaaaagaaacaatttttccaaatttgataaagagacattaaaaaaa
agaattcaagaatggaaatggtcaagtgatataaaaggtgctctaaaagtcaaaaagcat
gatccatataaaaattttattctcaccaaatttcagtgtaatgatcctgtaccagaatat
ataaaatatgaatatttatttaatgtggatgatgaccctcatgaggataacgattatgag
gaacactttcacatgcttgatgaaatattgaatgatgacgaggatttacctactatatca
agtttgtcttctttacaaggtttagaaaaggatgataatgtacaatctgaggaacactat
gaagatgatatatacaatgatgaaggtgtgaacgatataaatgaagacgaattaggaaac
attaatttcgaagatacaaaggattaa

DBGET integrated database retrieval system