KEGG   Plasmodium falciparum 3D7: PF08_0039Help
Entry
PF08_0039         CDS       T00095                                 

Definition
(RefSeq) 60S ribosomal protein L22, putative
  KO
K02891  
large subunit ribosomal protein L22e
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Ribosome
Module
Ribosome, eukaryotes
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    PF08_0039
Ribosome [BR:pfa03011]
 Ribosomal Proteins
  Eukaryotes
   Large subunit
    PF08_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(974659..974838,974939..975070,975233..975340)
Genome map
AA seq 139 aa AA seqDB search
MVAKKDSTKVSKKLKKKVVKKTKIVKGLKKQKMNKSTKGIKYVLDCTKPVKDTILDISGL
EQFFKDKIKVDKKTNNLKNKVVVTSDEYKIYITVHIPFSKRYIKYLAKKYIKMHQIRDFL
RVIAKGKLAYEFKYFQLNN
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaaaaaagatagtacaaaagtttccaagaagctcaagaaaaaagttgtaaag
aaaacaaaaattgttaagggtttgaaaaaacaaaagatgaacaagagtactaagggaatt
aaatatgttttggattgtaccaagcctgtaaaggatacaattttagatataagcggattg
gaacaatttttcaaggataaaattaaagttgataagaaaacaaataacttgaaaaataaa
gttgtagtaacatctgatgaatataaaatttatatcaccgtccacatacccttttctaaa
agatacataaagtatttggcaaagaagtatataaagatgcaccaaatacgtgacttctta
agagttatagctaaaggaaaattagcctacgaatttaaatactttcaattaaataattaa

DBGET integrated database retrieval system