KEGG   Plasmodium falciparum 3D7: PF08_0040Help
Entry
PF08_0040         CDS       T00095                                 

Definition
(RefSeq) clp1-related protein, putative
  KO
K14399  
polyribonucleotide 5'-hydroxyl-kinase [EC:2.7.1.78]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    PF08_0040
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.78  polynucleotide 5'-hydroxyl-kinase
     PF08_0040
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor IIm (CFIIm)
     PF08_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:970763..972787
Genome map
AA seq 674 aa AA seqDB search
MANNGNTRLYHLKAYHELRIVTLEKSTKYNEKEECIKIRILSSKNIHHKSNERKNPTDNI
NYSAEIFGKELILDKDYTFGYNEKFSIYTYTGCYIQIKGITLQEYESKNNTMKEYVSLCY
ILDAYRKLAKKKKKIGPRILITGNNNSGKSSVSLLLLNYALKSGFKPLYIETDTKASSDK
VELNRGPGVISCFKYDNMNNIVSMYPMASLNNINNNINNNNNNNNNNNNNSNNVELVNNN
NTINVNNNMFDSYMKYSLEYFFGYYDIKEDLNLYYHLNECISSCIYLMFLNNINNESTDL
RNYSNEQEHICSSGFILNVPSEADHEIVQNMIDIYNINIVIIIDNSFLHYSLKKYYHNIN
EDQQEYNNVEKENNLIKDRDKKSKQTNRLSEHNLLYDMNVFNDKDVNPDMRGSTVFTKNK
GEDGFYDDQKNEELKRGNYNNININNNNNNNNYYYNNDNVNNMYNMMYNNHQEDEEKKNI
QIIGMPKFEGVIPSDNNRIKYCRNLWYYNYFSRDININNYAFKKSHILSFKYSRTNFVKL
DTNLAVPLSALPSDCRDIKRENVSVSLYNGNVKNLINCILAVSYSKDFTYVHLINIAALI
HVQGIKEVEKTQQKQDNEKDKEKENNNSYVNQDGNNTEQHQVDYIFDILCPTYITLKNLP
PFFIIPGNIRQMKF
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atggcaaataatgggaatacccgactttatcatctaaaagcgtatcatgaacttcgtatt
gtgactcttgaaaaatctacaaaatataatgagaaggaggaatgtattaagattcgaatt
ttatcaagtaaaaatatacaccataaaagtaatgaaaggaaaaatccgaccgataatata
aattatagtgctgaaatatttggtaaggaattaatattagataaggattatacatttgga
tataacgagaagttttctatatatacatatactggttgctatatacaaataaaaggaata
actttacaagaatatgaaagtaaaaacaatacgatgaaagaatatgtatcattatgttat
atattagatgcgtatcgtaagttagcaaaaaaaaaaaagaaaatcggtcctagaatattg
ataacaggaaataataattctggaaaaagttcggtatcattacttttattaaattatgca
ttgaagtcaggatttaagcctttatatatagagacagatactaaagctagttcagataaa
gttgaattaaatcgagggcctggggtgattagttgttttaagtatgataatatgaataat
atagtaagtatgtaccctatggcaagtctaaataatatcaacaataatatcaacaataat
aataacaataataataacaataataataacagtaataatgttgagttagtcaataataat
aataccatcaatgttaataataatatgtttgattcgtacatgaaatattctctagaatat
tttttcggatattatgatattaaagaagatctaaacttatattatcatctgaacgaatgt
ataagtagttgtatatatctcatgtttttaaataatattaacaacgaatcaactgattta
agaaattatagtaacgaacaagaacatatatgctcctctggatttatattaaatgtgcct
tcagaagcagaccatgaaattgtacagaatatgatagatatatataatattaatattgtt
attattatagataattcttttttacattattcattaaaaaaatattatcataacataaat
gaagatcaacaggaatataacaatgttgagaaagaaaataatttaatcaaagatcgagat
aaaaaaagtaaacaaacgaataggttatctgaacacaatttattatatgatatgaatgtt
tttaatgataaagatgtgaatcctgatatgcgcggttcaactgtttttaccaagaataag
ggtgaagatggtttttatgatgatcagaaaaatgaagaattaaaaagaggaaattataat
aatataaatataaataataataataataataataattattattataataatgataatgtg
aataatatgtataacatgatgtataataatcatcaagaagatgaagaaaaaaaaaatatt
caaataattggcatgcccaaattcgaaggggttattccttccgataataatcgtataaaa
tattgtagaaatttatggtattataattatttttcaagagatataaatataaataattac
gcttttaagaaaagtcatatactatccttcaaatatagtagaacgaattttgtaaaatta
gatacaaatctagccgtacctttatcggctttaccatctgattgtagagatataaaaaga
gaaaatgtatccgttagtctatataatggaaatgttaaaaacttaataaattgtatttta
gcagtatcttattcaaaagattttacatatgtacatcttattaatatagctgcattaatt
cacgtgcagggtattaaagaagtcgaaaaaacacaacaaaaacaagataacgaaaaggac
aaagaaaaggaaaataataactcttatgttaatcaagatggaaataatactgaacaacat
caagttgattatatttttgatatattatgtccaacatatataacattgaaaaatttacct
ccattttttataatacctggaaatataaggcaaatgaaattctaa

DBGET integrated database retrieval system