KEGG   Plasmodium falciparum 3D7: PF08_0042Help
Entry
PF08_0042         CDS       T00095                                 

Definition
(RefSeq) ATP-dependent RNA helicase prh1, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(959605..960633,960786..961079,961534..962814))
Genome map
AA seq 867 aa AA seqDB search
MRELPILKYKHEIKKLIKKNNLIIIKGETGCGKTTQVPQIINEIFFDKKEKKYDNIKHKN
DEKKKRKEKKKMLISLPRRVATITVAERVSKEMKRGDIGNYVGYTIRFKNVCSDKTRIKF
VTDGILIREIMNDPLLKKYKFLILDEIHERSIRTDVLLGYTKILLQKRKKIKIILMSATF
DINIFNQFFNNPPIITIPHKLHKITIYYPRRNIEDYILSVVSTILQIHFGNTSYSSEFEN
DDDHRENKPNELNELNKSNEQNELNESNEVNKEHDSYESNKTHDINEIDEQNNLQTDNIS
MNNINEDIKKTEDKSLGDILVFLPGQEEIEMVNIMLKEKLKIIYKGNLLNKLMKERNNYN
NQNDFQNKINNKFNTDDHILNEICFHFGKTEIMPDKIYNMKILQLYSSLPNKKQKVIFEP
VPPNTRKVILSTNIAETSVTIPNIKYVIDSGKVKIKYFDVNRGSNVLRVTQISKDSAIQR
SGRAGREAPGQVYRIYTKEEYENMNPFLIPEIFRSDLTQIYLELKAMNINNPLEFNFPEN
PRKELFVHSAKMLFKINAIDMNNNLTDLGKKLCLFPLNPIYANILLCSIEFNCIDEIATI
VALLNCDSIFLNYNFYEDLDTLNNDSLDKKKNNNEQKKIVQKNSVEDSKENINKLENYDK
KKGKNNNLEPYDDDHDDNDNDSNNNDDDMGEKKMNDKNKLINVARRKLIHPDGDHLTLLH
IFYLWQEADIKEKKHFCNIYALNNEILQQVEKIKIQLLEIMKNKMKIEIPKKLHMHKWDQ
ILICLCKACFFNIAKSTSNTNVYINLVNKTKIRIHPSSTLFNSYIKPTFIFYSDIVQTKR
LYARIVTKIEADWLLKYVSAKFQVAKS
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgagagaattacccatattgaaatacaaacatgaaattaaaaaattgataaaaaaaaat
aatttaatcataataaaaggagaaacaggttgtggaaagactactcaagttccccaaata
ataaatgaaatattttttgataaaaaagagaaaaaatatgataatatcaaacataaaaat
gatgaaaaaaagaaaaggaaagagaaaaaaaaaatgttaatatctcttcctagaagagta
gcaactattactgttgctgaaagagtttccaaagaaatgaaaagaggtgatataggtaat
tatgttggttatactataagatttaaaaatgtatgttctgataaaactcgaataaaattt
gttacagatggtatattaattagagaaatcatgaatgatcctttattaaaaaaatataaa
tttttaattctcgatgaaattcatgaaagatctattagaaccgatgtcttattaggctat
acaaaaattttgttacaaaaaagaaaaaaaattaaaattatactaatgtctgcaacgttt
gatataaacatatttaatcaattctttaacaacccaccaattataactattcctcataag
cttcataaaattacaatatattatcctagaagaaatatagaagattatatcctgtcagtt
gtcagtacaattttgcaaatacattttggtaatacttcatattcatcggaatttgaaaat
gatgatgatcatagagaaaataaaccaaatgaattaaacgaattaaataaatcaaacgaa
caaaatgaattaaacgaatcaaacgaagtgaataaagagcacgactcgtacgaatcaaat
aaaactcacgatataaatgaaatagatgaacagaacaacctgcagacagataatatttct
atgaacaacataaatgaagatataaaaaagacggaggataaaagtcttggtgatatttta
gtattcttacctggtcaagaagaaatcgaaatggtaaatattatgttaaaagaaaaatta
aaaataatttataaaggaaatttattaaataaattaatgaaagaaagaaataattataat
aatcaaaatgattttcaaaataaaataaataataaatttaatactgatgatcatatactt
aatgaaatttgttttcattttggtaaaacggaaataatgccagataaaatttataatatg
aaaatcttacaactatattcatcacttccaaataaaaaacaaaaagttatatttgaacct
gttcccccaaacacaagaaaggtaattttaagtaccaacattgcagaaacatcggtgacc
attccgaatataaaatatgtaatcgacagcggaaaagtgaaaataaaatattttgatgta
aataggggaagcaacgttttaagagtaactcaaatatctaaagattctgcaattcaaaga
agtggaagagcaggaagagaagcgccaggacaggtatatcgaatatatacaaaagaggag
tatgagaatatgaatccttttttaatacctgaaattttccgttcagacttgactcaaata
tatttggaattaaaggccatgaatattaataacccacttgaattcaattttccagaaaat
ccaaggaaagaactttttgtacattcagcgaaaatgctttttaaaataaacgctatcgat
atgaataataatttaactgatttgggaaagaaactttgcttatttcctttaaatcctata
tacgctaatatattattatgttccatagaatttaattgtatagacgaaatagctactatt
gtagcattacttaattgtgacagtatttttttgaattataatttttatgaagatttggat
acgctaaacaatgactccttggacaaaaaaaaaaataataatgaacaaaaaaaaattgtg
caaaagaattctgttgaagattcaaaggaaaatataaacaaattagaaaattatgataaa
aaaaaaggaaaaaataataatcttgaaccatatgacgatgaccatgatgataatgataat
gatagtaataataatgacgatgatatgggagaaaaaaaaatgaatgataagaataaatta
attaatgttgcaagaagaaaacttatacatcccgatggggatcatttaacattattacat
attttttatttatggcaagaagctgatattaaagaaaaaaaacatttttgtaatatatat
gctttaaataatgaaatattacagcaagtagaaaaaataaaaatacaattattagaaatt
atgaaaaataaaatgaaaattgaaataccaaaaaaattacatatgcataaatgggatcaa
attttgatttgcttatgtaaggcatgtttttttaatatagccaaatcaacatcaaataca
aatgtttatataaatttagtgaataagacaaaaataagaattcatccatcatcaactctt
tttaactcttatattaaaccaacatttatattttattcggatattgtacaaacaaaaaga
ttgtatgctcgaattgtgacgaaaattgaggcagattggttattgaaatatgtatcagca
aaatttcaagtagccaaaagttaa

DBGET integrated database retrieval system