KEGG   Plasmodium falciparum 3D7: PF08_0044Help
Entry
PF08_0044         CDS       T00095                                 

Gene name
PfPK1
Definition
(RefSeq) protein kinase 1
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
Position
8:join(954523..955261,955339..956739,956850..957388)
Genome map
AA seq 892 aa AA seqDB search
MDLIKIYKRNEIIKDYVNIYFDDEKSENSNKNLSYKILHIIGNGVYGVVYKADCLNNCSI
VALKQTYQKSTRIFKEIEIMKKLKHPNIVKLKHAFYTSTNDGGVYVHMVMEYGNTDLASS
LYYITLKDSKEFLKDSFDLDNYNYEDYDDNKSEKDMLPNDQQKSDFYYYRSLPNQNEEMT
ADEKSGIHPGNNNMIVQGMINSNNNNNRDNNGDNNSSNNNSSNNNSSNNNSSNNNSSNNN
SSNNNSNMESCNYIKNNRRINIINHFKNSFFNENINNICSCHNISDFIKKSFLNENQIKI
YLYQLIRATLYLHSLCITHRDIKPQNILIFLNKTNKMKTNKTYINNKKCLICIQNNFNIQ
YIMKKKYNNQFNMFEFNNDMKDTRDEICNLDKTSDICDMSCDDKILNGDGISSCHKINNY
NNILYNSHNKSTNEQNYCEEVRNHDHVNDPCYNISNIKNNIHDKNKKENHTIDDDIQGND
NYSLKNEGQDDLQVCKNNDKKKKDLFVQEMQLCDKNKYEGSTSPSNDYNKYDKDCYNNNN
LMSNHDDCSAKNNLRLKRLVSMTNLNQRNYYMIINDNTDKICDKSITYDDDITKKKNKAN
INKLNIDKSKNDIISENKDTQIAPPNNSNNNNNNNCGDDDNFNHDDLPDQQSLDKLYINS
LMYKYIKLCDFNTSIKLKENYKYFSYVCSRYYRAPELLFGSNYYSQAIDTWSIGCVMGEL
LLGKPLFLGECASDQLVEIIKILGTPNDEDFLSFRSVYKNIKFPDIKPITLEKVIRHNCS
KESLDLLSELLQFNPQKRIKLCHALLHNYFDDIRNLKVFQKDINTFDKYKLPYNTNCFNF
TKEELLHFTIEERKILIPQHVRQNKSDEVMQYIDMTPDHFDKLYPNKIHLTC
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggacttaataaagatatacaagaggaatgaaataataaaagattatgtgaatatatat
ttcgatgatgagaaatcagagaacagtaacaagaatcttagttataaaatattacatatt
attgggaatggtgtttatggtgttgtttataaggcggattgtttaaataattgtagtatc
gtagctttaaaacaaacgtatcaaaaaagtacaagaatatttaaagaaatagaaattatg
aagaaattaaaacatcctaatattgtaaaattaaaacatgctttttatacaagtacaaat
gatgggggtgtatatgttcatatggttatggaatatggaaataccgatttggctagctcg
ctttattatattacattaaaggatagtaaagaatttttaaaagattcatttgatttagat
aattataattatgaagattatgatgataataaaagtgaaaaggatatgcttccaaacgat
caacagaaaagtgatttttattattataggtctcttcctaatcaaaatgaagaaatgaca
gcagatgaaaaaagtgggattcatccaggaaataataatatgattgttcaaggcatgatc
aatagtaataataataacaatagagataataatggagataataatagtagtaataataat
agtagtaataataatagtagtaataataatagtagtaataataatagtagtaataataat
agtagtaataataatagtaatatggaaagttgtaattatataaaaaataacagacgtata
aatattataaaccattttaaaaacagcttttttaatgaaaatataaacaatatatgttct
tgtcataacataagtgatttcataaaaaaaagcttccttaacgaaaatcaaattaaaatt
tatttgtaccaactaataagagctactttatatcttcatagtctttgtataactcataga
gacataaaaccacaaaatatacttatttttttaaataaaacaaataaaatgaaaactaat
aaaacctatataaataataaaaagtgtcttatatgtatacagaataattttaatattcaa
tatataatgaaaaaaaaatataataatcaattcaatatgtttgaatttaataatgacatg
aaggacacacgtgatgaaatatgtaatcttgataagacatcagatatttgtgacatgtca
tgtgatgataaaatattaaatggtgatggtatatccagttgtcataaaataaataattat
aataatatattatataatagtcataacaaatcgacgaatgaacaaaattattgtgaagaa
gttaggaatcatgaccatgtgaatgatccatgttataacatatcaaatattaaaaacaat
atacatgataagaataagaaagaaaatcatactatagatgatgatatacaaggtaatgat
aattattcattaaaaaatgaaggacaagatgatttacaggtttgtaaaaataatgataaa
aaaaaaaaagatttatttgtacaagaaatgcaattatgtgataagaataaatatgaagga
agtacatctccttccaatgattataataaatatgacaaagattgttataataataataat
ttaatgagtaatcatgatgattgttcagctaaaaataatttacgtttaaaaagattagta
agtatgacaaatttaaatcaacgaaattattatatgataataaatgataatacggataag
atatgtgataaatctataacatacgatgatgatataacaaagaaaaaaaataaagcaaat
ataaataaattaaatatagataaatcaaaaaatgatattatttcagaaaataaggatact
caaatagctccaccaaataatagtaataataataataataataattgtggagatgatgat
aattttaatcatgatgatctaccggatcaacaaagtttagataagctatatataaatagc
ttaatgtataaatatataaaattatgtgattttaatacctccatcaaattaaaggaaaat
tataaatatttcagttatgtgtgttctaggtattatagggcaccagaattattgttcggt
tcaaattattatagtcaagccatagatacatggtcaataggatgcgttatgggagaacta
cttttaggaaagcctttgtttttaggtgagtgcgcatcagaccaactagtcgaaataata
aaaattttaggaacaccaaacgatgaagattttttatcatttcgtagtgtttataagaat
ataaaatttccagatattaaaccaataacattagaaaaggttatacgtcataattgttca
aaggaaagcttggatttattatcagaattattacaatttaatccacaaaaaagaataaaa
ttatgtcatgcacttttacataattattttgatgatataagaaatttaaaagtatttcag
aaagatatcaatacatttgataaatataaattaccttataatacaaactgctttaatttt
acaaaagaagaattattacattttactatagaagagaggaaaatattaataccacaacat
gtaagacaaaataaatcagatgaagtgatgcaatatatagatatgacacctgatcatttt
gataaactgtatccaaataagatacacttaacatgctaa

DBGET integrated database retrieval system