KEGG   Plasmodium falciparum 3D7: PF08_0045Help
Entry
PF08_0045         CDS       T00095                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PF08_0045
  Amino acid metabolism
   00310 Lysine degradation
    PF08_0045
   00380 Tryptophan metabolism
    PF08_0045
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PF08_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(933417..933574,933764..936722)
Genome map
AA seq 1038 aa AA seqDB search
MRKFFYTNNLVRNNGKDIRTRSFHLSSCLYDYNFNPSMTSYIENTYKIWKEDRNNLHKSW
DSLFSMYPHAEMDNYNNPIKINRKTDNYNNSNCFQDVLKNNNLRITYVNNEMLEKGKTEN
IYDLARIVQLIRWYQKKGHLYANINPLPLPKEPPYSSVCYEPCKRKMSYVDFGFNEDDLD
KEFFFDLPSISGFSSNGMKKCNLRNLLKRLEETYCGTIGFEYMHITNENIVNYIIQRIEK
DKKYEYDTKMKKRILEYTARAFIFENYMAAKFATTKRFGVDGCETLITGMKALIKRAAQL
DVDSVLMSMSHRGRLNVLFNVLHKPLEQMMSEFRGKTGFSDNIWGNTGDVKYHLGVEIDY
YDEDSQRYIHMGIVDNSSHLESVDPILMGQARAQQYYCNDKEKKKVLPITIHGDASIAGQ
GIAYETFQMSKLPSYNVGGTIHIVVNNQIGFTTYPIDARSGKYCTDIAKCIDIPIIHVNA
DDPEAVTYVFELALDIRNKFNIDTIIDIVGYRRFGHNELDMPKFTNPLLYDVIARHKSVL
DIYSKKLIDENIISLKEFEDNKTEIFNFYEQVYEKSKSFVPTPKEKYLPQWEHMVTPQKF
SPSRKTGVEKDVLINLGKKIFTLRENFTAHPIITKLFKSRIDSLETGKNIDFGTAELLAY
ATLLSDGFHARLSGQDSQRGTFSHRHAVLHDQITYESYNIFDSLKTPHTIEVNNSLLSEY
ACLGYEIGYSYEHPDALVIWEAQFGDFANGAQVMIDNYIASGETKWNKQSGIVMLLPHGY
DGQGPEHSSARIERFLQLCDDREDIATYSVEKDNKIIQQHNMQVINCSKPSNFFHALRRQ
MHRSFRKPLIVITPKKMLKMRMAFDKIENFLTNTEFLPYLPEEVGHKLKDKKEIKRIILC
SGQVYYDLLNYRYTNKIDDVAIARIEQLSPFPFKQIMNDLQTYPNLRDIIWAQEEHMNMG
PWFYVSRRIEASIKQLKKDKPKWNIQIPQVRYSGRDVYAAQSAGDLNLHLYQLDEFLVDA
FNLDKKYNMHVQKYTDAL
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttttttacacaaataatttggtaagaaataatggaaaagatataagaaca
cgatcatttcatttaagttcttgcttatatgattataattttaacccaagtatgacctcg
tatattgagaatacatataagatatggaaagaagacagaaacaatttacacaaatcgtgg
gactctttatttagcatgtatccacatgcagaaatggataattataataacccaataaaa
ataaatcgaaagactgataattataataatagtaattgttttcaagatgtgcttaagaat
aataatcttcgaattacatatgtgaataatgaaatgcttgaaaaagggaaaacagaaaat
atttatgatctagctaggattgttcaattaattagatggtatcaaaagaaaggacattta
tatgctaatataaatcctttgccattaccaaaagaacctccctatagtagtgtttgttat
gaaccttgtaaaaggaaaatgtcttacgtggattttggttttaatgaggatgatttagat
aaagagtttttttttgatttgccgtcgattagtggtttttcaagtaatggtatgaaaaaa
tgtaatttaagaaatttattaaaaagattagaagaaacatattgtggtactattggtttt
gaatatatgcatataacaaatgaaaatatagtaaattatataatacaaagaatagagaag
gacaaaaaatatgaatatgatacaaagatgaaaaaaagaattttagaatatactgctcga
gcatttatatttgaaaattatatggcagctaaatttgctacaacaaaaagatttggagtt
gatggatgtgaaacattaattactggtatgaaagcattaataaaaagggctgctcagtta
gatgtagatagtgtattgatgagtatgtctcatcgaggtcgattgaatgttttatttaat
gtattacataaaccattagaacaaatgatgtcagaatttcgagggaaaactggttttagt
gataatatatggggaaataccggagatgtaaaataccatttaggtgttgaaattgattat
tatgatgaagattcacaaagatatatacatatgggtatagtagacaattcgtctcattta
gaatctgttgatcctattttaatgggtcaagctagagcacaacaatattattgtaatgat
aaagaaaaaaagaaagtgttaccaataactatacatggagatgcttcaatcgctggacaa
ggaattgcatatgaaacatttcaaatgtctaaattaccaagttataatgtgggtggtact
atacatattgtggttaataatcaaataggatttaccacatatccaatagatgcaaggtca
ggaaaatattgtacagacatagctaaatgtatagatataccaattatacatgtaaatgca
gatgatccagaagctgtaacatatgtatttgaattagcattagatattcgaaataaattt
aatattgatacaattattgatattgtaggttataggagatttgggcataacgaattagat
atgccaaaatttacgaatccattattatatgatgtaatagctagacataaatctgtttta
gatatatatagtaaaaaattaattgatgaaaatattattagtcttaaagaatttgaagat
aataaaactgaaatatttaatttttatgaacaagtgtatgagaaatccaaatcatttgta
ccaacacctaaggaaaaatatttacctcaatgggaacatatggtaacaccccaaaaattt
tctccctcacgaaaaacaggagtagaaaaagatgtattaataaatcttgggaaaaagata
tttacattacgtgaaaatttcactgctcatccaataataacaaaattatttaaaagtaga
atagatagtttagaaacaggcaaaaatatagattttggtaccgctgaattattagcttat
gcaactttattatctgatggattccatgcacgtttatctggtcaggattcacaaagagga
actttttctcatcgacacgcagtattacatgatcaaataacatatgaatcatataatata
tttgattcattaaaaacaccacataccatagaagtaaataattctcttttatctgaatac
gcatgtttaggttatgagataggatatagttatgaacatccagatgctcttgttatttgg
gaagctcaatttggtgattttgctaatggagctcaggttatgattgacaattatattgca
tctggtgaaacaaaatggaataaacaatcgggtattgttatgttattacctcatggatat
gatggacaaggtcctgagcattcatctgctcggatagaacgttttttacaattgtgtgat
gatagagaagatatagctacctattctgttgaaaaagataataagattattcagcagcat
aatatgcaggttataaattgtagtaaaccatctaattttttccatgcattaagaagacaa
atgcatagatcttttaggaaaccattaattgtaataacacctaagaaaatgttgaaaatg
agaatggcatttgataagattgaaaattttttaacgaacactgaatttttaccttattta
ccagaagaagttggtcataaattgaaagataaaaaagaaatcaaaagaattatattatgt
tcaggacaagtatattatgatttattaaattatagatatacaaataaaattgatgatgta
gctattgccagaatagaacaattatctcctttcccctttaaacaaataatgaatgatctg
caaacttatccaaatttgagagatattatatgggcacaagaagaacatatgaatatgggt
ccatggttttatgtctctcgtcgtattgaagcatctataaaacaattaaaaaaagataaa
ccaaaatggaatattcaaattcctcaggtacgttattcaggaagggatgtatatgcagcg
caatcagcaggtgatcttaatttacatctttatcaattagatgaatttttagttgatgca
tttaatttggataaaaaatataacatgcatgttcaaaaatataccgatgcgttataa

DBGET integrated database retrieval system