KEGG   Plasmodium falciparum 3D7: PF08_0048Help
Entry
PF08_0048         CDS       T00095                                 

Definition
(RefSeq) ATP-dependent helicase, putative
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNF2_N Helicase_C HSA
Motif
Other DBs
NCBI-GeneID: 2655499
NCBI-ProteinID: XP_002808863
PlasmoDB: PF08_0048
GeneDB: PF08_0048
UniProt: C0H4W3
Position
8:complement(join(901838..902038,902245..908034,908284..908359,908517..908549,908662..908810))
Genome map
AA seq 2082 aa AA seqDB search
MNEIKSESLLQTRPFKLGIEDIQNLGSSYFIENNEKLKKYNNEISSLKKELDILNEKMGK
CTTTTKIVEPAKTPEFTFWYYELKEMKGFQDLVMYEVKKKKKHFKVLSHSCLKYLSNREK
MKIKKQEEEEKRLKLYSKNISSYMDVFWKKIEKLVWEEKKRELQQTLNKKKEMRFKKFVK
EAIKKIKDARHNNAHELFENKYVSMSSNNNSEIVNNNASSVDNGDKELKEDDLTDQEEED
YLLDEQMSSTDESENKEEEINMLDDEANLPIEELLKRMYGFKSGEDYINFMENEDDANEE
NVIETSHNDEKSGDNSIGEDDNNNDEKGGDNNIDEDDNNNDEKSGDNSIGEDDNNNDHKS
GDNNIDEDDNNNDHKSEDNSIGEDDNNNDEKGGDNNIDENDNNSDHKSEDNNIDENDNNS
DHQSDQEQFNHETKDDIIKNSSYEHIDNKNYYNKTGEDYKSDKENYSPTRFHNKLKKEKY
DEYDTKLKIEKREEENKNYEKDEHEYESDNYDKEKINKKKELILLKNDIENDSDETSEHI
KRDSRSSCQKQNCEKKRRIIKDEYNLRRTKIAKSKPSSDNNNSENDNNNDNNNDNNNDNN
DDNNDDNNDDNNDDNNDDNNDDNNDDNNNEHKNDSDDNDDILTCNMDEKHLTKIPPIIKA
TLRDYQHAGLHWLLYLYKNNINGILADEMGLGKTLQCISLLSYLAYYFNIWGPHLVIVPT
SILINWEIELKRFCPCFKILSYYGNQNERYKKRVGWFNKDSFHICISSYSTVVKDHLVFK
RKRWKYIILDEAHNIKNFNTKRWNIILSLKRDNCLLITGTPLQNSLEELWSLLHFLMPNI
FTSHLDFKEWFSDPLNLAIEKSKIHHSKELIDRLHTVIRPYILRRLKKNVEKEMPNKYEH
IIKCKLTRRQQILYDEFINNKNVQNTLNTGNYIGLMNILIQLRKVCNHCDLFTNKYIQTP
YYYMLSIRYFVPRFFILFEKNYYADFYLILFLHNEFTSLGGRDVTKETSPSSKSFDLAHI
LTKHNTNELYDNNHISELYDNNHISELYDNNHISELYDNNHISELYDNPMSHKNYKHNSN
GYTYPNDPINNMNNNPSGFTKTSEQFGQIVSHERDNNYHMMDHNNMNNLLSKEMVNSLRN
DDNSNNNFYKYSLTSNNNDSQTSIHDNKQCDYNKLCADTFNNINSIGNEEKRSLNVLNEQ
NNNNSKDNNNNIDNNNNIDNNNNIDNNNNIDNNNNIDNNNNNIDNNNNIDNHHNNNQHCN
YNDNWPSDYPTNIINHRNAFLSILKLLNQSNPLNNDNNNNNNNNNGNNNIYNMNRYNSRN
SRNSSLSNIFSSNTSKMNSFQLDFLYTNSFINQDALCKNSFFVNINIEDVHSYIYNSIYK
EYIPKNILSFSDEFLTELNNNYDILSLYIDPYNRYKSYNEYLYKMKEEGTLTNQQSLGDI
NNKHIYHKSTSNENTHMKNRKTFIYKYNNMFKVINNDTQYQNIFTDDTNNSYYNSLEHNL
WIKRNQIDERKKEEEEEQNKYYNVCMNNLYILRNERIPIFGKNFLDLIKKEFTKDKNIVY
NYTNNVPIDYYSSVKEVWVEDICEKDNKKRKCKREKRWYKKIKKTNNPPEDSEVYRENSS
DVEKYNCDVEKDNCDDEEKDNCDDEDMNSNLSSNVYGCIDISSQNFIHSRYHNPMMNMSY
IIEFLFPNMEQFLKRHEKMIHNFTLINNPSVICKSHDIRINNNLLNYSNDKMNPIILQIK
NATRVYHDAFLKQSIIFPLNKDISLGSGKLCALEKLLSKCKREGNKCLLFTQFIKMLDIL
EIFLNHLNYSFIRLDGSTKVEQRQKIVTKFNNDKSIFIFISSTRSGSIGINLTAANVVIF
YDTDWNPSIDKQAMDRCHRIGQTKDVHVFRFVCEYTVEENIWKKQLQKRKLDNICINMGN
FNNSNTHSKITDTDPTHNKDWFTNVDTIKEVFINKKNNDDDDDMYKDRLLHEQVENKDKM
NVRFEKTLEHVEDKDDIRALNETKKETQNEISQNMQEFTTRNDFQDSYNLTSYCFNFLNE
NLTDSLKQQIDEMRMKIEIEMMNTGDENMSLSDLSNKSHNSE
NT seq 6249 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaataaaatctgaaagtttattgcagacaagaccattcaagttaggtattgag
gatattcaaaatttagggtcgtcatattttatcgaaaacaatgaaaaactgaaaaaatac
aataatgaaatcagttcattgaaaaaagaactggacattttaaatgaaaaaatggggaaa
tgtactacaacaacgaagattgtcgaaccagccaaaactcctgaatttaccttctggtat
tatgaacttaaagaaatgaaaggatttcaggatctggttatgtatgaagtaaagaagaag
aaaaaacacttcaaagttttgagccacagttgcctaaaatatttaagcaatcgagaaaag
atgaaaataaaaaaacaagaagaagaagagaaaagattaaaattatattcaaagaatata
tcgtcttatatggatgtattttggaagaaaatagaaaagctagtatgggaagaaaaaaag
cgagaattacaacaaacattaaataaaaaaaaagaaatgagatttaaaaagtttgtaaaa
gaagccataaaaaaaataaaagatgctagacataataatgctcatgaattatttgaaaat
aaatatgttagcatgagctcaaataataacagtgaaattgttaataataatgcatcatcc
gttgataatggtgataaagaattaaaagaagatgatcttaccgatcaagaagaagaagat
tatctcttggatgagcaaatgagctcgactgatgaatctgaaaacaaagaagaagaaatc
aatatgttagatgatgaagcaaacctacccattgaagaattgttgaaaagaatgtatggt
tttaagagtggagaggattatataaattttatggaaaatgaagacgacgcaaatgaagag
aatgtaattgaaacgagtcataatgatgaaaaaagtggagataatagcattggtgaggat
gataataataatgatgaaaaaggtggagataataacattgatgaggatgataataataat
gatgaaaaaagtggagataatagcattggtgaggatgataataataatgatcacaaaagt
ggagataataacattgatgaggatgataataataatgatcacaaaagtgaagataatagc
attggtgaggatgataataataatgatgaaaaaggtggagataataacattgatgaaaat
gataataatagtgatcacaaaagtgaagataataacattgatgaaaatgataataatagt
gatcaccaaagtgatcaagagcaatttaatcatgagactaaggatgacataattaagaat
tcctcgtatgaacatattgataataagaattattataataagacaggagaagattacaaa
agtgataaggaaaattattcaccaaccagatttcataataaattaaaaaaggaaaaatat
gatgaatatgatacaaagctgaaaatagaaaaaagagaagaagaaaataaaaattatgaa
aaggatgaacatgaatatgaaagtgataattatgataaggaaaaaataaataaaaaaaaa
gaattaattttattaaaaaatgatatcgaaaacgattcagatgaaacctctgaacatata
aaaagagatagtagatcatcttgtcaaaaacaaaattgtgaaaagaaaagaagaattata
aaagatgaatataatttaagaaggacaaaaatagctaaaagtaaaccatctagcgataat
aacaatagtgagaatgataataataatgacaataataatgacaataataatgacaataat
gatgacaataatgatgacaataatgatgacaataatgatgacaataatgatgacaataat
gatgacaataatgatgacaataataatgagcacaaaaatgatagtgatgataatgatgat
atattaacatgtaacatggatgaaaaacatttaacaaaaatccctcctattattaaagcg
accttacgagattatcaacatgcagggttacattggttattatatttatataaaaataat
attaatggtatattagctgatgaaatgggtttaggaaagacattacaatgtatatcattg
ttaagttacttagcttattattttaatatatggggtccacatttagtaatagtaccaaca
tctatattaataaattgggaaattgaattaaaacgtttttgtccatgttttaaaatttta
tcatattatggaaatcaaaatgaaagatataaaaaaagagttggatggtttaataaagat
tcttttcatatatgcatttctagttattcaactgttgtaaaagatcatttagtttttaaa
aggaaaagatggaaatatataatattagatgaagctcataatataaaaaattttaataca
aaacgttggaatattatattaagtttaaaaagagataattgtttattaattacaggtacc
cctttacaaaatagtttagaagagttatggtctttacttcattttcttatgccaaatata
tttacatctcatttggattttaaggaatggttttcagatcctttaaatttagctatagaa
aaaagtaaaattcatcattccaaagaattaatagatagattacatacagttatacgtcca
tatattttaagaagattaaagaaaaatgtagaaaaagaaatgccaaataaatatgaacat
ataattaaatgtaaattaacacgaagacaacaaatattgtatgatgaatttataaataat
aaaaatgtacaaaatacattaaatacaggaaattatataggattaatgaatatattaata
caattaagaaaggtatgtaatcattgtgatttgtttactaataaatatatacaaacacct
tattattatatgttatcaattcgttattttgtacctcgtttttttattttatttgaaaaa
aattattatgcagatttttatctaatactttttcttcataatgaatttacatctctgggt
ggtcgagatgttaccaaagaaacaagtccatcttccaaatcatttgaccttgctcatatt
ctaacgaaacataatactaatgaattgtatgataataatcacatttctgaattgtatgat
aataatcatatttcagaattgtatgataataatcatatttctgaattgtatgataataat
catatttctgaattgtatgataatccaatgagtcataaaaattacaaacataattcaaat
ggttatacgtatccaaatgatcctattaataatatgaataataatccatctggatttaca
aaaacgagtgaacaatttggtcagattgtatcacatgaaagggataataattatcatatg
atggatcataataatatgaataatttattatcaaaagaaatggtaaattccttgagaaac
gatgataattcaaataataatttttataaatattctctcacatctaataataatgattcg
cagacaagtatacatgataacaaacaatgtgattataataagttatgtgcagatactttt
aacaatattaatagtattgggaatgaggaaaaacgttccctaaatgttttaaacgaacaa
aacaacaacaatagtaaagataataataataatatagataataataataatatagataat
aataataatatagataataataataatatagataataataataatatagataataataat
aataatatagataataataataatatagataatcatcataataataaccaacattgtaat
tataatgataattggccaagtgattatccaactaatattattaatcataggaatgctttt
ctttccatactaaaactcttgaaccaaagcaaccctcttaacaacgacaataataataat
aataataataataatgggaataataatatatataatatgaacagatataatagtcgtaat
agtcgtaatagctcgctgtctaatattttttcatcgaatacaagtaaaatgaattcattc
caacttgattttctatacacgaacagttttataaatcaagatgctctatgtaagaattct
ttttttgttaacataaatatagaagatgttcatagttatatttataatagtatatataaa
gaatatattcctaagaatattttaagtttttctgatgaatttctcaccgaattaaataat
aattatgatattctttccttgtatattgatccatataatagatataaaagttataatgaa
tacctatacaaaatgaaagaagaaggaacattaacaaatcaacaatcattaggcgatata
aataataaacatatttatcataagagtacatctaatgaaaatacacatatgaaaaatagg
aaaacatttatttacaaatataataatatgtttaaagtaattaataatgatacacaatat
caaaatatttttacggatgacacaaataattcgtattataattcattagaacataattta
tggattaaaagaaatcaaatcgatgaaagaaaaaaagaagaagaagaggaacaaaataaa
tattataatgtgtgtatgaataatttatatatattaagaaatgaaagaatacctatcttt
ggtaaaaattttctagacttaattaaaaaagaatttacaaaggataaaaatattgtttat
aattatacgaacaatgttcctattgattattattcatcagtgaaggaagtttgggttgag
gatatttgtgaaaaggataacaaaaagaggaaatgtaaaagagaaaagagatggtacaag
aaaataaagaaaacaaacaatccaccagaagatagtgaggtttacagagaaaatagtagt
gacgtagaaaaatataattgtgatgtagaaaaagataattgtgatgatgaagaaaaagat
aattgtgatgatgaagatatgaattctaatttatcttctaatgtgtatggatgtattgat
atatcatcacaaaattttattcattccagatatcataatccaatgatgaatatgtcttat
ataattgagttcttatttcctaatatggaacaatttttaaaacgacatgaaaagatgata
cataattttacgttaataaataatccatccgtgatatgtaaaagtcatgatataagaata
aataataatttattaaattatagtaatgataaaatgaatccaataattttacaaataaaa
aatgctactagggtatatcatgatgcatttttaaaacaatcaatcatcttccctttaaat
aaagatatatcattaggaagtgggaaattatgtgccctagagaaattattaagtaaatgt
aaaagagaaggaaataaatgtttattatttacacaatttattaaaatgttagatatatta
gaaatttttttaaaccatttaaattattcttttataagattagatggatctacaaaagta
gaacaacgtcaaaaaattgtaaccaaatttaataatgataaatccatttttatatttata
tcttccacacgtagtggtagtataggtattaatttaacagcagcaaatgtcgtcattttt
tatgacaccgattggaatccatcaattgataaacaggctatggatagatgtcatcgtata
ggacaaacaaaagatgtacatgtttttagatttgtttgtgaatatactgtagaagaaaat
atatggaaaaaacaattacaaaaaaggaaactagataatatttgtataaatatgggaaat
tttaataactcaaatacccattcaaaaataacagacacagatcctacacataataaagat
tggtttactaatgttgatacaatcaaggaagtatttattaacaaaaaaaataatgatgat
gacgacgatatgtataaagatagattattacatgaacaagtcgaaaataaagataaaatg
aatgtccgttttgaaaaaacattagagcatgttgaggataaggatgatatacgtgcatta
aatgagactaaaaaggagacacaaaatgagatatctcaaaatatgcaagagtttactaca
cgtaatgacttccaagacagctataatctcacatcgtactgcttcaatttcttaaacgaa
aatctaacagactccttaaaacaacaaattgatgaaatgagaatgaaaattgaaattgaa
atgatgaatacgggagatgaaaatatgtccctcagtgacttatcaaataaatcccataat
tcagaataa

DBGET integrated database retrieval system