KEGG   Plasmodium falciparum 3D7: PF08_0049Help
Entry
PF08_0049         CDS       T00095                                 

Definition
(RefSeq) lsm3 homologue, putative
  KO
K12622  
U6 snRNA-associated Sm-like protein LSm3
Organism
pfa  Plasmodium falciparum 3D7
Pathway
RNA degradation
Spliceosome
Module
Spliceosome, U4/U6.U5 tri-snRNP
Lsm 2-8 complex
Lsm 1-7 complex
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    PF08_0049
  Folding, sorting and degradation
   03018 RNA degradation
    PF08_0049
Messenger RNA biogenesis [BR:pfa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     PF08_0049
  mRNA degradation factors
   5'-3' decay
    Lsm complex
     PF08_0049
Spliceosome [BR:pfa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   LSm proteins
    PF08_0049
 Complex C
  U2 snRNP components
    PF08_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:complement(join(900100..900174,900319..900408,900539..900624,900729..900753))
Genome map
AA seq 91 aa AA seqDB search
MEKIALIQNPLDYIRLNMEEEIFLKCKGDRELIGKLDAYDNHLNMILSNVRETYKYSVKE
NDEETVKKMERNLDMVFVRGDSIILVSSAMK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatagcattaatacaaaatcccttagattatattcgtttaaatatggaggaa
gaaatatttttaaaatgtaaaggagatagagaactcattggaaaattagatgcttatgat
aatcacttaaatatgattttatccaatgtacgtgagacttataaatatagcgttaaagaa
aatgatgaagaaacagtcaagaaaatggaaagaaatttagacatggtttttgttagagga
gattctattatcctagtatcatctgctatgaaataa

DBGET integrated database retrieval system