KEGG   Plasmodium falciparum 3D7: PF08_0095Help
Entry
PF08_0095         CDS       T00095                                 

Gene name
DHPS, PPPK
Definition
dihydropteroate synthetase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PF08_0095 (DHPS)
Enzymes [BR:pfa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     PF08_0095 (DHPS)
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PF08_0095 (DHPS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
8:join(549321..549456,549633..551501,551622..551737)
Genome map
AA seq 706 aa AA seqDB search
METIQELILSEENKTNIAVLNLGTNDRRNAVLILETALHLVEKYLGKIINTSYLYETVPE
YIVLDKKESCEKINKDCRIYDVNYINELMQNLEESKYEENKELIDKCEEYETFLKNGKVD
NSILKEVNVENYLLECNNIIVKNDEIMKNNLSKYKDKYYTSYFYNLTVVVKTFVNDPLSM
LVVIKYIEELMKRENVKEKEKFENRIIDIDILFFNDFTIFMKNIKLEKNMIYKILSKYIH
LERDIKNGNDNMSKVNMDKDINLNNNNNIKKKNNNDIDCDCVDQKMNNHVNNKNYINSFR
DPQEIINNMVDNIEFLSIPHVYTTHRYSILLCLNDMIPEYKHNVLNNTIRCLYNKYVSRM
KEQYNINIKENNKRIYVLKDRISYLKEKTNIVGILNVNYDSFSDGGIFVEPKRAVQRMFE
MINEGASVIDIGGESSGPFVIPNPKISERDLVVPVLQLFQKEWNDIKNKIVKCDAKPIIS
IDTINYNVFKECVDNDLVDILNDISACTNNPEIIKLLKKKNKFYSVVLMHKRGNPHTMDK
LTNYDNLVYDIKNYLEQRLNFLVLNGIPRYRILFDIGLGFAKKHDQSIKLLQNIHVYDEY
PLFIGYSRKRFIAHCMNDQNVVINTQQKLHDEQQNENKNIVDKSHNWMFQMNYMRKDKDQ
LLYQKNICGGLAIASYSYYKKVDLIRVHDVLETKSVLDVLTKIDQV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatacaagaactaatactttctgaggaaaataaaactaatattgccgtatta
aacttaggaacaaatgatagaagaaacgctgtgttgattctagaaactgctctgcacctt
gtcgaaaaatatttaggaaaaattattaatacgtcctacttgtatgaaaccgttccagaa
tacattgtattagataaaaaggaaagttgcgaaaaaataaacaaggattgtcgtatatat
gatgttaattatataaacgaattgatgcaaaatttagaagaatctaaatatgaagagaat
aaagaattaattgataaatgtgaagaatatgaaacatttttgaaaaatggaaaagttgat
aatagtattctaaaggaagtaaatgtagaaaattatttattagaatgtaataatataata
gtaaagaatgacgaaataatgaaaaataatttaagcaaatataaagataaatattatact
agctacttttataatttgacagttgtagttaaaacttttgtaaatgatcctcttagtatg
ttggtagttataaaatatattgaagaattaatgaaaagggaaaatgtaaaagagaaagaa
aaatttgaaaatcgtataatagatatagatattctattttttaatgattttacaatcttt
atgaaaaacataaaattggaaaaaaatatgatttataaaatactctcaaaatatattcat
ttggaaagagatataaaaaatggaaatgacaatatgtctaaagtaaatatggataaagat
ataaatcttaataataacaataatataaaaaaaaaaaataataatgatattgattgtgat
tgtgtggatcagaagatgaataatcatgtgaataataaaaattatataaattcttttaga
gatccacaagaaataataaacaatatggtagataatattgaatttttatccattcctcat
gtgtatacaacacacagatatagcatacttttatgcttaaatgatatgatacccgaatat
aagcataatgttttaaataataccatcagatgtttatataacaaatatgtgagtaggatg
aaagaacaatataatataaatattaaagaaaataataaaaggatatatgtattaaaagat
agaatttcttatttaaaagaaaaaacaaatattgttggaatattaaatgttaattatgat
tctttttcagatggaggtatttttgttgaacctaaacgtgctgttcaaagaatgtttgaa
atgataaatgaaggtgctagtgttatagatataggtggagaatcctctggtccttttgtt
atacctaatccaaaaattagtgaaagagatttagtagtacctgtattacaattatttcaa
aaagaatggaatgatataaaaaataaaattgttaaatgtgatgcgaaaccaattataagt
attgatacaattaactataatgtttttaaagaatgtgttgataatgatttagttgatata
ttaaatgatattagtgcttgtacaaataatccagaaattataaaattattaaaaaaaaaa
aacaaattctatagtgtagttctaatgcataaaagaggaaatccacatacaatggataaa
ctaacaaattatgataatctagtttatgatataaaaaattatttagaacaaagattaaat
tttcttgtattaaatggaatacctcgttataggatactatttgatattggattaggattt
gcgaagaaacatgatcaatctattaaactcttacaaaatatacatgtatatgatgagtat
ccactttttattggatattcaagaaaaagatttattgcccattgcatgaatgatcaaaat
gttgtaataaatacacaacaaaaattacatgatgaacaacaaaatgaaaataaaaatatt
gtggacaaatcacacaattggatgtttcagatgaattacatgaggaaagacaaggatcaa
cttttatatcaaaaaaatatatgtggtggattagcaattgcttcctacagctattataaa
aaggtagatctaataagagttcatgacgttttagaaacaaaatcggttttggatgtttta
acaaaaatagaccaagtgtaa

DBGET integrated database retrieval system