KEGG   Plasmodium falciparum 3D7: PF10_0275Help
Entry
PF10_0275         CDS       T00095                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PF10_0275
Enzymes [BR:pfa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     PF10_0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
10:1163784..1165613
Genome map
AA seq 609 aa AA seqDB search
MSEYKKYNVPSHEIYDVILIGGGLFNCCLYYYLKLKNSELSIIIVEKEENLGGYIKTYTY
NIDDKKILVELGPNMFKLCNESYNLINKLNLLSSVRLLDDTLIRYIYIKNDKLYPLYLNI
FSYLSFPLINISNKIKLLFKLIFKQYKNLNSYTNDISVENYMNDNFDSQHYNFLLLPFIY
GSCAGNGKISAVSFFSRNLKLFHNKVNSLYIWNEKIKSEEKNRNIKCVNNNTFIYQHMNK
KKKNFNLFTPCYNFFYISNKNMKMDVYLNVLYNYYSSNKKTEKKNVFNYICYRIPILLLH
MKQFSINIFRHISIFLKCTYQFFYPFLMLPDLAKWTTSHFDDEKKKKKNLIGKTVTFKNG
LYELIDKLQSHMNKEFIYTNHEVDFIEKAYNNLWMCNIKHENQNKTIYGKNIVLAVNSKI
CSNIMRNILPVNIRDILLNFSYSSIISISLYFKKSDINIPKNFFGFLSSDKCAHILGCFH
INNMFKERCHDDNKVLLTLYMGGSNHPNDITLDEYEIKEIISNDLKNIFDIYNDAQPNIL
KIHKWKDAIPFYSYNYEKLLKKVMEELNKLSYKNLYLDSGWITGTSISDRIRSAQDLCEY
IFSLTNLAS
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatataaaaaatataatgtaccttcacatgaaatttatgatgttattttaatt
ggtggtggcttatttaattgctgcctgtactattatttaaaattaaaaaattctgaactg
tctataataatagtagaaaaagaagaaaacttaggagggtatataaagacatatacatat
aatattgatgataaaaaaatattagtagagttaggtccgaatatgtttaaattatgtaat
gagagttataatttaattaataaacttaatttactttctagtgttagattattagacgat
acacttataagatatatatatataaaaaatgataaattatatccgttgtatttaaatata
ttttcttatttatctttccctttaataaatatttcaaataaaattaaattactcttcaaa
ttaatctttaaacaatataaaaatttaaattcatatacaaacgatatatctgtggaaaat
tatatgaacgataatttcgattcacaacattataattttttacttttaccttttatatat
ggctcgtgtgcaggtaatggcaaaatatctgcagtctccttcttctcaagaaatttaaag
ctttttcataataaagtgaactctttatatatatggaatgagaaaattaaaagcgaagaa
aaaaataggaatataaaatgtgttaataataatacttttatttatcaacatatgaataaa
aaaaaaaaaaattttaatttatttacaccatgttataattttttttacatttcaaataaa
aacatgaaaatggatgtatatttaaatgtcttatacaattactattcctcaaataagaag
acagaaaaaaaaaatgtatttaattatatttgttacaggattcctattttgttattacat
atgaaacaattttctattaatatatttcgtcatatttctatatttctaaaatgtacatac
caattcttttacccttttttaatgttacctgatctagccaaatggacgactagccatttt
gatgatgaaaaaaaaaaaaaaaaaaatttaattggaaaaactgttacctttaaaaatggt
ttatatgaattaatagataaattacagagtcatatgaataaagaatttatatatacaaat
catgaagtcgattttattgaaaaggcttataacaatttatggatgtgtaacatcaaacat
gaaaatcaaaataaaacaatatatggtaaaaacattgttttagctgtaaattcgaaaata
tgttctaatattatgaggaacattttaccggttaacataagagatatacttttaaatttt
tcgtattctagtattataagtatatcattatattttaagaaaagtgatataaatattcca
aaaaacttttttggatttttatcatctgataaatgtgcacatatcttgggatgttttcat
ataaataatatgtttaaagaaagatgtcatgatgataataaagtattattaactttatat
atgggtggatcaaatcatccaaatgatattactttagatgaatatgaaattaaagaaata
atttcaaacgatttaaaaaacatatttgatatatataatgatgcacaacctaatatttta
aaaatacacaaatggaaagacgcaataccattttattcatataattatgagaaactctta
aaaaaagttatggaggaattaaataaattgtcttataaaaatttgtacctcgattctgga
tggataactggaacgtcaatatcggatagaataagatctgcacaggatttgtgcgaatat
atcttttctctgacgaatcttgcatcataa

DBGET integrated database retrieval system