KEGG   Plasmodium falciparum 3D7: PF10_0407Help
Entry
PF10_0407         CDS       T00095                                 

Definition
dihydrolipoamide acyltransferase, putative (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pfa  Plasmodium falciparum 3D7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pfa01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pfa00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pfa00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pfa00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
10:join(840211..840453,840663..840729,840834..841223,841339..841418,841500..841546,841647..841742,841865..841945,842050..842092,842195..842274,842339..842822,843091..843402)
Genome map
AA seq 640 aa AA seqDB search
MLYNLIILIFYLRFSKCISKNNNYGYINFGTFSNVVNNSNNLRNRKNVVFSKIEIKMPAL
SSTMTTGKIVKWNKNIGDYVNLGDIIMTVESDKADMDVEAFDEGFLRVKRLEDGCEANVG
DVLGVLTTEENENMDEKKYNDGDINKTENEIKVLNPDKDKSEQIIKEDIHFVKKHINDDV
NEEKIFIPFIKCKKKKAKINKWLKNENDFVKKNDLLLYVEDDKSTIEVESPYSGIIKKLL
VKEGQFVDLDKEVAIISITEEKDNEKEKIEEPFKNKEDEEINRDNILIHYINKIKKSEEG
RKFLKNLSEQEEKTLEERLKLNYEKYNKISNDLFRSSESTKDYVLKEKENESQYEMVLPS
ASELMRQNKLNPKDITNRKTPNRITYEDVDAFLNGHKNNSTNVTYCEKPKVETIEYGDPK
TVDMTNIQKSIKNNMMLTLTVPVFRVTHLIKTNELLKLYEKVKQKISMSVIINKCVSSVL
LNHPLIYSTYIDKDNGKILYNKDVNIGNALGLPDSLLTPVLKKVDKKDIYTLANEWKILV
EKGKNGLLSSNDMTGSNFYISNLGMFNTYQFDAILPKNSSCILSIGTNIGSIDNLEDLKI
QKGMMMTLTCDHRHIYGSHAAAFMNDLSKFIEKDIMKIFL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgttatacaacttaattatattaattttttatttaagattttctaaatgtatttctaag
aacaataattacggttacatcaacttcggtaccttttcaaatgttgtaaacaacagtaat
aatttaagaaatagaaaaaatgttgttttttcaaaaatagaaataaaaatgccagctcta
tctagtaccatgacgacaggcaaaattgttaaatggaataaaaatataggagattatgta
aatctaggtgatattataatgaccgttgaaagtgataaagcagacatggacgtggaagca
tttgatgaaggctttttaagggttaagcgtttagaagatggatgtgaagcaaatgttgga
gatgtcctaggagttttaactacagaggaaaacgaaaatatggatgaaaagaaatataat
gatggggacattaacaagacagagaacgaaataaaagtattgaatcctgataaagacaaa
agtgaacaaattataaaagaagatattcattttgtaaagaagcatataaatgatgatgta
aatgaagagaaaatatttattccttttataaagtgtaaaaaaaagaaagcaaaaataaat
aaatggttaaaaaatgagaatgattttgtaaagaagaatgatttgttactttatgtagag
gatgataaaagcaccatagaagtggaaagtccatattctggtataataaaaaaattatta
gtcaaggaaggacagttcgtagatttagacaaagaagttgccatcatctcaataacagag
gaaaaagataatgaaaaagaaaaaatagaagaaccttttaaaaataaagaagatgaagaa
ataaatcgagataatatattaatacattatataaataaaatcaagaaaagtgaagaggga
agaaagtttttaaaaaatttaagtgaacaagaagaaaaaacactggaagagaggctcaaa
ttaaattatgagaaatacaataaaatttccaatgatctattcaggtctagtgaaagtaca
aaagattatgtattaaaagaaaaggaaaatgagagccaatatgaaatggtgttaccatct
gcatcagagttgatgagacaaaacaaattaaatccaaaggatataacaaacaggaaaaca
cccaatcgtataacctatgaagacgttgatgcatttttaaatggacataaaaataattct
actaatgttacttactgcgaaaaaccaaaagttgaaacaattgaatatggagatccaaaa
actgtcgatatgacaaatatacagaaatcaataaaaaataatatgatgcttaccttaacc
gttccagtgttccgtgttactcatttaataaaaacaaacgaattactgaaattatatgaa
aaagtaaaacaaaaaattagtatgagtgttataataaataaatgtgtatcatctgtacta
ttaaatcatcccttgatatactctacttatattgataaagataatggaaaaatattatat
aataaggatgttaatataggaaatgcattaggattaccagattctctattaactcctgtg
ttaaaaaaagttgataaaaaggatatatatacattggccaatgaatggaagatactagtt
gagaaaggtaaaaatggtctcttaagttctaatgatatgacaggtagtaatttttacatt
tccaatttgggaatgttcaatacttaccaatttgatgcaatattgccaaagaattcatca
tgtatcttatcaatcggcacaaatattggaagtattgataacctggaagacttaaaaata
caaaagggaatgatgatgactttgacatgtgaccacagacatatctatggatcccatgca
gcagcgtttatgaatgatttatcaaaatttattgaaaaggatattatgaaaatattttta
tag

DBGET integrated database retrieval system