KEGG   Plasmodium falciparum 3D7: PF11_0053Help
Entry
PF11_0053         CDS       T00095                                 

Definition
PfSNF2L
Organism
pfa  Plasmodium falciparum 3D7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
11:complement(join(182384..182425,182589..182708,182841..183080,183179..183262,183430..187224))
Genome map
AA seq 1426 aa AA seqDB search
MFRNVRDYFKSSNDVNEEKKNDVGSVHMDENTENYDKESNGFVHRDFNNGINKEDKDYEE
LDLKKLNVSSNDITKEGNNMNENMMNRKLNSSVEDGNDNNHDKNVHRNIGNDTHVSYDDK
RKSYLDNNEENSEQMNDNMKKRKLNEISYDNNEEDEFRNKKDDSMEMNDKEKGSTNMSTI
NDNNNNHNDDSNNHNDDSNNHNDDSNNHNDDSNNHNDDNNNHNEDNNNHNDDNNNHNDDN
NYNSEEKPNYLQEKLEQLLAQTKRYTEKLAGQRLKMNAQMKSSKKGRCLLTEKEEDFMLL
KDANEEDEAIILKQPMNINGTMKPYQLEGLNWLYQLYRFKINGILADEMGLGKTLQTISL
LCYLRFNKNIKKKSIIICPRSTLDNWYEEIKKWCTPMKAFKYYGNKDQRKELNRNLLHSD
FDVLLTTYEIVIKDKSALYDIDWFFLVIDEAHRIKNEKSVLSSSVRFLRSENRLLITGTP
LHNNLKELWSLLNFLMPKIFDNSEEFDNLFNISKISTNDNKQSEIITQLHTILKPFMLRR
LKVEVEQSLPPKREIYIFVGMSKLQKKLYSDILSKNIDVLNAMTGSKNQMLNILMQLRKC
CNHPYLFDGIEEPPYIEGNHLIETSGKMSLLDKLLPRLKKENSRVLLFSQMTRLLDIIDD
YCRWKNYPYLRIDGSTPGDERQVRINQFNEPNSKYFIFLLSTRAGGIGINLTTADIVILF
DSDYNPQMDIQAMDRAHRIGQKKRVIVYRFVTQNSVEEKIVERAAKKLKLDSLIIQKGKL
NLNSAKENNKQELHDILNFGAPEVYKTQDISSISDEDIDIILADAEKRTIEIEKKLKNLE
NIFDLTNISLDGGLNMYNDLEKEASEESTDEEDSSGSGEETILEGSGNNDIVEENGVKKK
KKKKKNINKIRRTIKKFLKNNKKNMTFLDLGERKSKWKVMNTACGRTNKKKMVLHGWRAE
ARGGHDFQFFNVEKLDELEKIEDKWNNYMINQEKINVLIEAQNEEKDYEKIVTFNEFLDK
HAKNIYQIITLINPSLFDEHKDTKEEELLKMGTHSDVNSNDKDYKRSSFMSTDYNMKTTY
LNNINSNNNNNNNNINDNVGTSINTIDDQQYFKKKILSLFESGKKLQMIKFKDRNIKNCY
TQVANFIKKNFPEKINNNDTNNNKSTTLKNKKLKKGKQTKNVNVEKDIASVDIEKIKLQK
QELMKQGFAKWNKAEFNKLMSGLIIYGTNEVEYIYEKYFSNSKKSMEDIKAYLTVFFRKY
DQIKGGVRLFDKIKRSDLQKKIIEEENDMITEFVEKQLSEGVDSIEKLQLPSNLRYDFME
KREVLNITEEVKTENEENVLSNEELAYYDRENKILLWLLYQQGVVQIKNIHILTPYYWPE
AYNFFKYATTPFENVEYRCRLIVDAIAELYAKKENVPLNNKDKRRI
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgtttagaaatgttcgtgactatttcaaaagtagtaatgatgtaaacgaggaaaagaaa
aacgacgtgggaagtgttcatatggatgagaatactgagaattatgataaagaatctaat
ggctttgttcatagagattttaataatggtataaataaagaagataaggattatgaggaa
ttagatttaaaaaagttaaatgttagttctaatgatattacaaaagaaggtaataatatg
aatgagaatatgatgaataggaaattgaattcaagtgtagaggatggtaatgataataat
catgataagaatgttcataggaatattggtaatgatacacatgtttcctatgatgataag
agaaaaagttatttggataataatgaagagaattctgaacaaatgaatgataatatgaag
aaaaggaaattaaatgaaatatcatatgataataatgaagaagatgaatttaggaataaa
aaggatgattctatggaaatgaatgataaagaaaagggttcaactaatatgagtactatt
aatgataataataataaccataatgatgatagtaataaccataatgatgatagtaataac
cataatgatgatagtaataaccataatgatgatagtaataaccataatgatgataataat
aaccataatgaagataataataaccataatgatgataataataaccataatgatgataat
aattataatagtgaagagaaaccgaattatttacaagaaaaactagaacaattacttgca
caaacaaaacgatatacagaaaaattagcaggacaaagattaaaaatgaatgcacaaatg
aaaagtagtaaaaaaggacgctgtttattaacagaaaaagaagaagattttatgttactt
aaggatgcaaatgaagaagatgaagctataattttaaaacagccaatgaatattaatggt
acgatgaaaccttatcaattagaaggtttgaattggttatatcaattatatcgttttaaa
ataaatggtattttggctgatgaaatgggtttaggtaaaacattacaaaccattagttta
ttatgttatttacgatttaataagaatataaaaaagaagagtattataatatgtcctaga
tcgactttagataattggtatgaagaaataaagaaatggtgcacacccatgaaagctttt
aaatattatggaaataaagatcaaagaaaagaattaaatagaaatttattacattcagat
tttgatgtattattaacaacttatgaaattgttataaaggataagagtgcattatatgat
attgattggttttttttggtaatagatgaagctcatcgaattaagaatgaaaagagtgta
ttgagttcatctgtacgtttcttaagatctgaaaatagattattaattactggtactcct
ttacataataatttaaaagaattatggtctcttttaaattttttgatgcctaaaatcttt
gataactcagaagaatttgataatttgtttaatatatcaaaaataagtacgaatgataat
aagcaaagtgaaataataacacaattacataccatattaaaaccatttatgcttcgaaga
ttgaaagtcgaagtagagcaatcattaccacctaaaagagaaatatatatatttgttggt
atgtctaaattacaaaagaaattatattcggatatattaagtaaaaacattgatgtatta
aatgctatgacaggtagtaaaaatcaaatgcttaatattttaatgcagttaagaaaatgt
tgtaaccatccatatttatttgatggcattgaagaaccaccatatattgaaggcaatcat
ttaattgagacatctgggaaaatgtctttattagataaattattacctagattaaaaaaa
gagaattcgagagtattacttttttcacaaatgacaagattgttagatattattgatgat
tattgtcgatggaaaaattacccatatttaagaattgatggatcaacaccaggagatgaa
agacaagtacgtattaatcaatttaatgaaccgaatagtaaatattttattttcttatta
tctaccagagctggtggtattggtattaacttaacgactgctgatattgttattttattt
gattcggattataatccacaaatggatatacaagcaatggatcgagctcatcgtatcggt
cagaaaaaacgagttattgtgtatcgatttgttacacaaaattctgtagaagaaaaaatt
gtagagagagcagcaaagaagttaaaattagattctttaatcattcagaaagggaaatta
aatttaaatagtgcaaaggaaaataataaacaagaattacacgatatattaaattttggt
gcacctgaagtttataagacacaagatatttcatcaatatctgatgaagatattgatata
atcttagccgatgcagaaaaaagaacaattgaaattgaaaagaaattaaaaaatctagaa
aatatttttgatttaactaatatatcattagatggtggtttgaatatgtataatgattta
gaaaaggaagcttctgaagaatcaaccgatgaagaagattcatcaggttcaggggaagaa
actattttagaaggttctggtaataatgacattgttgaagaaaatggtgtaaaaaaaaag
aagaagaaaaaaaagaatattaataaaattaggagaactataaagaaatttttaaaaaat
aataagaagaatatgacatttttagatttaggagaaagaaaaagtaaatggaaagtaatg
aacactgcatgtgggagaactaataaaaaaaaaatggtacttcatggatggagagctgaa
gctagaggtggtcatgatttccaattttttaatgtagagaaattagatgaattagaaaaa
atagaagataaatggaataattatatgatcaatcaagaaaaaatcaatgtactaatagaa
gcacaaaatgaagaaaaggattatgaaaaaattgtaacctttaatgaattcttagataaa
catgcaaaaaatatatatcagataattactttgatcaatccaagtctatttgatgagcac
aaggataccaaagaggaagaattattaaaaatgggtacccattcggatgttaattcgaat
gataaggattataaaagaagtagttttatgagtacagattataatatgaaaactacctac
ctaaataacatcaacagtaataataataataataataataatattaatgataatgtagga
acaagtattaacactattgatgatcaacaatacttcaagaagaaaattttgtcccttttt
gaatcaggaaaaaaattacaaatgataaaatttaaagacagaaatataaaaaattgttac
acacaagtagcaaattttataaagaaaaacttcccagaaaaaattaataataatgatact
aataataataaaagtactactttgaagaataaaaaattaaagaaaggaaaacaaacgaaa
aatgtaaatgtagaaaaggatatagctagtgtagatattgaaaaaataaaattgcaaaaa
caagaattgatgaaacaaggttttgcaaaatggaataaagctgaatttaataaattgatg
agtggtttaataatatatggtactaatgaagttgaatatatatatgaaaaatattttagt
aattccaaaaaatcgatggaagatataaaagcatatctgactgtattctttagaaaatac
gaccaaatcaaggggggtgtaaggctttttgataaaattaaaagatcagacctacagaaa
aaaattatagaagaagaaaatgatatgattaccgaatttgttgagaaacagctctcagaa
ggagttgatagtatagaaaaattacaactaccatcaaatttgagatatgattttatggaa
aagagagaggttttaaatataacagaagaggtgaaaactgaaaatgaagaaaatgtttta
agtaatgaggaattagcttattatgatagagaaaataaaatcttgttatggttattatat
cagcaaggagtagttcaaattaaaaatatacacattttgaccccctattattggcctgag
gcttataacttttttaagtatgcaacgactccattcgaaaatgttgaatatcgatgtagg
ttaattgttgatgctattgcagaattatacgcaaagaaggaaaacgttcccttaaataat
aaagataaaagaagaatttga

DBGET integrated database retrieval system