KEGG   Plasmodium falciparum 3D7: PF11_0062Help
Entry
PF11_0062         CDS       T00095                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
pfa  Plasmodium falciparum 3D7
Brite
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF11_0062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
11:226066..226419
Genome map
AA seq 117 aa AA seqDB search
MVSKKPAKAKKTGTGPDGKKKRKKSRYDSYGLYIFKVLKQVHPDTGISRKSMNIMNSFLV
DTFEKIATEASRLCKYTRRDTLSSREIQTAIRLVLPGELAKHAVSEGTKAVTKFTSK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtatcaaaaaaaccagctaaagctaaaaaaaccggaactggtccagatggaaagaaa
aaaagaaaaaagtcaagatatgacagctatggactttatatcttcaaagttttgaaacaa
gtacacccagatactggtatttcaagaaaatccatgaacatcatgaattcattccttgtt
gatactttcgaaaaaattgcaactgaagcttcaagattatgcaaatatacaagaagagat
accttatcatcacgtgaaattcaaactgccataagattagttttaccaggagaattagct
aaacacgcagtttctgaaggaaccaaagctgtaacaaaatttacctccaaataa

DBGET integrated database retrieval system