KEGG   Plasmodium falciparum 3D7: PF11_0147Help
Entry
PF11_0147         CDS       T00095                                 

Gene name
map-2
Definition
(RefSeq) mitogen-activated protein kinase 2
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pfa  Plasmodium falciparum 3D7
Brite
KEGG Orthology (KO) [BR:pfa00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    PF11_0147 (map-2)
Enzymes [BR:pfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     PF11_0147 (map-2)
Protein kinases [BR:pfa01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   PF11_0147 (map-2)
Chromosome [BR:pfa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     PF11_0147 (map-2)
Exosome [BR:pfa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PF11_0147 (map-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Structure
PDB: 

Jmol
Position
11:complement(534972..536498)
Genome map
AA seq 508 aa AA seqDB search
MLKKKKDYENADLEDCNTKEIKGYSKVGSEKNIKKKMTSIKESSSRDEEEEDANVNKNIK
KFKEGNKKDNISKNCNIVEKKNNKSKEEKINIKEAIIKNVKVPDNYEIKHLIGRGSYGYV
YLAYDKNANKNVAIKKVNRMFEDLIDCKRILREITILNRLKSDYIIRLHDLIIPEDLLKF
DELYIVLEIADSDLKKLFKTPIFLTEQHVKTILYNLLLGEKFIHESGIIHRDLKPANCLL
NQDCSVKICDFGLARTINSDKDIHIVNDLEEKEENEEPGPHNKNLKKQLTSHVVTRWYRA
PELILLQENYTNSIDIWSTGCIFAELLNMMKSHINNPTNRFPLFPGSSCFPLSPDHNSKK
VHEKSNRDQLNIIFNVIGTPPEEDLKCITKQEVIKYIKLFPTRDGIDLSKKYSSISKEGI
DLLESMLRFNAQKRITIDKALSHPYLKDVRKENLENFSTEKIILPFDDWMVLSETQLRYI
FLKEIQSFHADLIIPAKLNIHQKSFYNM
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaaaaaaaaaggattacgaaaatgctgatttagaggattgcaataccaaagag
ataaagggatattcaaaagtagggagcgaaaaaaatataaaaaaaaaaatgacttctata
aaagagtctagtagtagggatgaagaagaagaagatgctaatgtaaataaaaatattaaa
aaatttaaagaaggcaataaaaaagacaatatttcaaaaaattgtaatattgtagaaaag
aaaaataataaaagcaaagaagagaaaataaatatcaaagaagctattattaaaaatgta
aaggtaccagataattacgaaataaaacatttgattggtagaggatcctatggatatgta
tatttagcttatgataaaaatgcaaataaaaatgtggctataaagaaggttaatagaatg
tttgaagatttaatagattgtaaaagaatattaagagaaataacaatattgaatagatta
aagagtgattatattataagattacatgatttaattattcctgaagatttattaaaattt
gatgagttatatatagtattagaaattgcagattctgatttaaagaaattatttaaaaca
ccaatatttttaacagaacaacatgtaaaaacaatattatataatttattactaggagaa
aaatttattcacgaatcaggtataatacacagagatttaaagccagctaattgtttatta
aatcaagattgttcagtaaagatatgtgactttggtttagctagaacaattaattcagat
aaagatattcatattgttaatgatttagaagaaaaagaagaaaatgaagaaccaggtcca
cataataaaaatttaaaaaaacaattaactagtcatgtagttactaggtggtatagggca
ccagagcttatattattacaagagaattatacaaattctatagatatatggtcgactggt
tgtatatttgctgaactattaaatatgatgaagagtcatataaataatccaactaataga
tttcccttatttcctggatcttcttgttttcctttatcacctgatcataattcaaaaaaa
gttcatgaaaaaagtaacagggatcaattaaatataatatttaatgtaataggtacacca
ccagaagaagatttaaaatgtataacaaaacaagaagttattaaatatattaaattattt
cctacaagggatggtatagatttaagtaaaaaatattcatctatatctaaagaaggtata
gatttattagaatccatgttacgatttaatgctcaaaaaagaataactattgataaggct
ttatcacacccttatcttaaggatgtaagaaaagaaaatttagaaaatttctcaaccgaa
aaaataatacttccatttgatgattggatggttctatcagaaacacaacttagatatatt
ttcttaaaggaaattcaatcatttcatgctgatttaattatacctgcaaagttaaatata
catcaaaaaagtttctacaatatgtaa

DBGET integrated database retrieval system