KEGG   Plasmodium falciparum 3D7: PF11_0177Help
Entry
PF11_0177         CDS       T00095                                 

Gene name
UCH54
Definition
deubiquinating/deneddylating enzyme
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
pfa  Plasmodium falciparum 3D7
Brite
Enzymes [BR:pfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     PF11_0177 (UCH54)
Peptidases [BR:pfa01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   PF11_0177 (UCH54)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
PlasmoDB: 
GeneDB: 
UniProt: 
Position
11:652578..653975
Genome map
AA seq 465 aa AA seqDB search
MARDNENILEEWCLIESNPCIFYDMLKRMGATEISVEDVYSLSYFDDYINNKEIINMNHI
LGVDTYLGENNKTLDKENNVVDVIELYKNNICMEDKYNKLLKHHSYIYGIIFLFNIGKHY
KNNKYIEHNVPDNLFFAKQVIPNACATQAILSIVLNKDIELNDEIKNIKTFSLNFDSSMK
GLTLSNCTFLRNIHNSYKPPIYLDKEDVHHDKKKSEDSFHFVSYISFQDKVYLLDGLQSG
PVLINADEQNKPNPNNNNNNKDNDNDNNNNNNNNNNNNNNNNNNNNNNNNNNIGMNGKDW
IEISREHIKKEIDEICNSQTNNDVRFNIIAVMKDKEYIIQEYINIHRIVKQRVNIKLINL
GENIELSDEINEDEFPLLNDIPSIENLPNNVDTLYNIVNKSTLEINYLQSLLHEQKEIKK
LWNKELTFKFFNFYPFIMSSLNLMAKHKLLKDAYQKEKLKNATKS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgagggataatgaaaacattttagaagagtggtgtttaatagaaagtaacccgtgt
atattttatgatatgcttaaacgtatgggtgctacagaaatttcagtagaagatgtgtat
agtttatcttattttgatgattatataaataataaggagattataaatatgaatcatata
ttgggtgttgatacatatttaggagaaaataataaaacgctggataaagagaataatgtt
gttgatgttatcgaattatataagaataatatatgtatggaagataaatataataaatta
ttaaaacatcatagttatatttatggtataatatttttatttaatattggaaagcattat
aaaaataataaatatattgagcataatgttcctgataatttattttttgctaaacaagtt
ataccaaatgcatgtgctacacaagctattttgtctattgtgttgaataaggatatagaa
ttaaatgatgaaataaaaaatataaaaacatttagtttaaatttcgatagttcaatgaaa
ggattaacattatcaaattgtacttttcttcgtaatatacataattcatataaacctcca
atatatttagataaagaggatgtacatcatgataaaaaaaaaagtgaagactcctttcat
tttgtttcctatattagttttcaggataaagtatatttattggatggtttacaaagtggc
cccgtgcttataaatgcagacgagcaaaataaacccaacccaaacaataacaacaataat
aaggataatgataatgataataataacaacaataacaataataataacaataacaacaat
aacaacaataacaacaataacaataataataacaatattgggatgaatggaaaagattgg
atagaaatttctagagaacatataaaaaaagaaatagatgaaatatgtaattcacaaact
aataatgatgttcgttttaacattattgccgttatgaaagataaagaatacattattcaa
gaatatataaatatacatcgcatagttaaacaaagagttaatatcaaattaattaacctt
ggagaaaatattgaactatcagatgaaattaatgaagacgaatttcccttattaaacgat
ataccctcaatagaaaacctaccaaacaatgtagatactttatataatatagtaaataaa
tcaaccttagaaattaactatttacaatcattattacatgagcaaaaagaaataaaaaaa
ttatggaataaagaactgacttttaaattttttaatttctatcctttcataatgtcttct
cttaatttaatggctaagcataagttattaaaagatgcttatcaaaaagaaaaattaaaa
aatgcaacaaaatcttga

DBGET integrated database retrieval system